Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPARASample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit PPARA Polyclonal Antibody | anti-PPARA antibody

PPARA antibody - N-terminal region

Gene Names
PPARA; PPAR; NR1C1; hPPAR; PPARalpha
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPARA; Polyclonal Antibody; PPARA antibody - N-terminal region; anti-PPARA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNI
Sequence Length
468
Applicable Applications for anti-PPARA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of human PPARA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPARASample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPARASample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PPARA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysatePPARA is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Western Blot (WB) (WB Suggested Anti-PPARA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysatePPARA is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Western Blot (WB)

(WB Suggested Anti-PPARA antibody Titration: 1 ug/mLSample Type: Human heart)

Western Blot (WB) (WB Suggested Anti-PPARA antibody Titration: 1 ug/mLSample Type: Human heart)
Related Product Information for anti-PPARA antibody
This is a rabbit polyclonal antibody against PPARA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
peroxisome proliferator-activated receptor alpha
NCBI Official Synonym Full Names
peroxisome proliferator activated receptor alpha
NCBI Official Symbol
PPARA
NCBI Official Synonym Symbols
PPAR; NR1C1; hPPAR; PPARalpha
NCBI Protein Information
peroxisome proliferator-activated receptor alpha
UniProt Protein Name
Peroxisome proliferator-activated receptor alpha
UniProt Gene Name
PPARA
UniProt Synonym Gene Names
NR1C1; PPAR; PPAR-alpha
UniProt Entry Name
PPARA_HUMAN

NCBI Description

Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PPAR-alpha: Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl- 2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety. Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2. Belongs to the nuclear hormone receptor family. NR1 subfamily.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 22q13.31

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein domain specific binding; ligand-dependent nuclear receptor activity; NFAT protein binding; zinc ion binding; drug binding; phosphatase binding; protein binding; DNA binding; ubiquitin conjugating enzyme binding; sequence-specific DNA binding; protein complex binding; steroid hormone receptor activity; transcription factor activity; lipid binding

Biological Process: circadian rhythm; epidermis development; wound healing; heart development; positive regulation of transcription, DNA-dependent; behavioral response to nicotine; negative regulation of transcription from RNA polymerase II promoter; cellular lipid metabolic process; fatty acid metabolic process; negative regulation of appetite; response to insulin stimulus; positive regulation of gluconeogenesis; circadian regulation of gene expression; negative regulation of blood pressure; negative regulation of protein binding; negative regulation of glycolysis; transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; lipoprotein metabolic process; regulation of circadian rhythm; positive regulation of fatty acid beta-oxidation; positive regulation of fatty acid oxidation; response to hypoxia; gene expression; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; lipid metabolic process; fatty acid transport

Research Articles on PPARA

Similar Products

Product Notes

The PPARA ppara (Catalog #AAA3201309) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPARA antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPARA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPARA ppara for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTEYQYLGSC PGSDGSVITD TLSPASSPSS VTYPVVPGSV DESPSGALNI. It is sometimes possible for the material contained within the vial of "PPARA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.