Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KLF15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Rabbit KLF15 Polyclonal Antibody | anti-KLF15 antibody

KLF15 antibody - middle region

Gene Names
KLF15; KKLF
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLF15; Polyclonal Antibody; KLF15 antibody - middle region; anti-KLF15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVP
Sequence Length
416
Applicable Applications for anti-KLF15 antibody
Western Blot (WB)
Homology
Dog: 91%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KLF15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KLF15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-KLF15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)
Related Product Information for anti-KLF15 antibody
This is a rabbit polyclonal antibody against KLF15. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KLF15 is a Cys2-His2 zinc finger gene. It is found abundantly expressed in the liver, kidneys, heart, and skeletal muscle.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
Krueppel-like factor 15
NCBI Official Synonym Full Names
Kruppel like factor 15
NCBI Official Symbol
KLF15
NCBI Official Synonym Symbols
KKLF
NCBI Protein Information
Krueppel-like factor 15
UniProt Protein Name
Krueppel-like factor 15
Protein Family
UniProt Gene Name
KLF15
UniProt Synonym Gene Names
KKLF
UniProt Entry Name
KLF15_HUMAN

Uniprot Description

KLF15: Transcriptional activator. Binds to the GA element of the CLCNKA promoter. Belongs to the Sp1 C2H2-type zinc-finger protein family.

Protein type: Transcription factor; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: nucleus

Molecular Function: protein binding; metal ion binding

Biological Process: cardiac muscle hypertrophy; glial cell differentiation; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; glucose transport

Research Articles on KLF15

Similar Products

Product Notes

The KLF15 klf15 (Catalog #AAA3200631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLF15 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLF15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLF15 klf15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPIPVLLQIQ PVPVKQESGT GPASPGQAPE NVKVAQLLVN IQGQTFALVP. It is sometimes possible for the material contained within the vial of "KLF15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.