Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Mouse cornea and eyelidPrimary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit-AlexaFluor-546Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PPARG: Green DAPI: RedGene Name :Ppar Gamma Submitted by :Anonymous)

Rabbit PPARG Polyclonal Antibody | anti-PPARG antibody

PPARG antibody - N-terminal region

Gene Names
PPARG; GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARgamma
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
PPARG; Polyclonal Antibody; PPARG antibody - N-terminal region; anti-PPARG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI
Sequence Length
505
Applicable Applications for anti-PPARG antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Mouse cornea and eyelidPrimary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit-AlexaFluor-546Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PPARG: Green DAPI: RedGene Name :Ppar Gamma Submitted by :Anonymous)

Immunohistochemistry (IHC) (Mouse cornea and eyelidPrimary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit-AlexaFluor-546Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PPARG: Green DAPI: RedGene Name :Ppar Gamma Submitted by :Anonymous)

Western Blot (WB)

(WB Suggested Anti-PPARG Antibody Titration: 1.25ug/mlPositive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-PPARG Antibody Titration: 1.25ug/mlPositive Control: 293T cell lysate)
Related Product Information for anti-PPARG antibody
This is a rabbit polyclonal antibody against PPARG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
peroxisome proliferator-activated receptor gamma isoform 2
NCBI Official Synonym Full Names
peroxisome proliferator activated receptor gamma
NCBI Official Symbol
PPARG
NCBI Official Synonym Symbols
GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARgamma
NCBI Protein Information
peroxisome proliferator-activated receptor gamma
UniProt Protein Name
Peroxisome proliferator-activated receptor gamma
UniProt Gene Name
PPARG
UniProt Synonym Gene Names
NR1C3; PPAR-gamma
UniProt Entry Name
PPARG_HUMAN

NCBI Description

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

PPAR-gamma: a transcription factor, member of the nuclear hormone receptor superfamily. Receptor for hypolipidemic drugs and fatty acids. Preferentially expressed in adipocytes as well as in vascular smooth muscle cells and macrophage. Regulator of adipogenesis and lipid metabolism, modulates insulin sensitivity, cell proliferation and inflammation. Phosphorylated and inhibited by MAP kinase. Heterodimerizes with the retinoid X receptor. Interacts with NCOA6 coactivator, leading to a strong increase in transcription of target genes. Two splice-variant isoforms have been described.

Protein type: DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 3p25

Cellular Component: nucleoplasm; perinuclear region of cytoplasm; nucleus; cytosol

Molecular Function: ligand-dependent nuclear receptor activity; transcription activator binding; zinc ion binding; drug binding; alpha-actinin binding; protein phosphatase binding; arachidonic acid binding; retinoid X receptor binding; protein binding; enzyme binding; ligand-dependent nuclear receptor transcription coactivator activity; DNA binding; prostaglandin receptor activity; sequence-specific DNA binding; steroid hormone receptor activity; estrogen receptor binding; chromatin binding; transcription factor activity

Biological Process: heart development; negative regulation of collagen biosynthetic process; positive regulation of transcription, DNA-dependent; cell maturation; rhythmic process; lipid homeostasis; glucose homeostasis; response to lipid; response to caffeine; response to vitamin A; positive regulation of oligodendrocyte differentiation; placenta development; long-chain fatty acid transport; organ regeneration; cell fate commitment; monocyte differentiation; negative regulation of acute inflammatory response; regulation of circadian rhythm; response to starvation; negative regulation of telomerase activity; cellular response to insulin stimulus; response to mechanical stimulus; response to estrogen stimulus; lipoprotein transport; brown fat cell differentiation; positive regulation of fat cell differentiation; steroid hormone mediated signaling; positive regulation of transcription from RNA polymerase II promoter; fatty acid oxidation; positive regulation of transcription factor activity; positive regulation of phagocytosis, engulfment; negative regulation of transcription, DNA-dependent; negative regulation of smooth muscle cell proliferation; low-density lipoprotein receptor biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; signal transduction; epithelial cell differentiation; regulation of blood pressure; response to nutrient; caspase activation; transcription initiation from RNA polymerase II promoter; response to retinoic acid; G-protein coupled receptor protein signaling pathway; response to low density lipoprotein stimulus; white fat cell differentiation; positive regulation of fatty acid oxidation; innate immune response; gene expression; response to cold; lipid metabolic process; negative regulation of cell growth

Disease: Obesity; Carotid Intimal Medial Thickness 1; Lipodystrophy, Familial Partial, Type 3; Diabetes Mellitus, Noninsulin-dependent

Research Articles on PPARG

Similar Products

Product Notes

The PPARG pparg (Catalog #AAA3201219) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPARG antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PPARG can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PPARG pparg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SHSFDIKPFT TVDFSSISTP HYEDIPFTRT DPVVADYKYD LKLQEYQSAI. It is sometimes possible for the material contained within the vial of "PPARG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.