Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ULBP-3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 59 kDa.)

ULBP-3 recombinant protein

Recombinant Human ULBP-3 Protein

Gene Names
ULBP3; N2DL-3; RAET1N; NKG2DL3
Purity
>95% by SDS-PAGE.
Synonyms
ULBP-3; Recombinant Human ULBP-3 Protein; N2DL-3; NKG2DL3; RAET1N; ULBP-3 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
GRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAP
Sequence Length
244
Species
Human
Endotoxin
< 0.01 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ULBP-3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 59 kDa.)

SDS-Page (Recombinant Human ULBP-3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 59 kDa.)
Related Product Information for ULBP-3 recombinant protein
Description: Recombinant Human ULBP-3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly27-Pro216) of human ULBP-3 (Accession #NP_078794) fused with an Fc, 6xHis tag at the C-terminus.

Background: ULBP-3 is a member of a family of cell-surface proteins that function as ligands for human NKG2D. ULBP-3 has also been described under the names RaeT1N (retinoic acid early transcript), NKG2DL3, and ALCAN-gamma. The name ULBP-3 derives from the original identification of three proteins, ULBP-1, -2, and -3, as ligands for the human cytomegalovirus glycoprotein UL16; they were designated UL16 binding proteins (ULBP). The gene for ULBP-3 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. Amino acid sequence identity within this family ranges from 30-60%. These proteins are distantly related to MHC class I proteins, but they possess only the alpha 1 and alpha 2 Ig-like domains, and they have no capacity to bind peptide or interact with beta 2?microglobulin. Some family members, including ULBP-3, are anchored to the membrane via a GPI-linkage, whereas others have transmembrane domains.
Product Categories/Family for ULBP-3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
UL16-binding protein 3
NCBI Official Synonym Full Names
UL16 binding protein 3
NCBI Official Symbol
ULBP3
NCBI Official Synonym Symbols
N2DL-3; RAET1N; NKG2DL3
NCBI Protein Information
UL16-binding protein 3
UniProt Protein Name
NKG2D ligand 3
UniProt Gene Name
ULBP3
UniProt Synonym Gene Names
N2DL3; RAET1N; N2DL-3; NKG2DL3
UniProt Entry Name
N2DL3_HUMAN

NCBI Description

The protein encoded by this gene is one of several related ligands of the KLRK1/NKG2D receptor, which is found in primary NK cells. Binding of these ligands to the receptor activates several signal transduction pathways, including the JAK2, STAT5, and ERK pathways. The encoded protein is expressed solubly and on the surface of many tumor cells, making it potentially an important target for therapeutics. [provided by RefSeq, Nov 2015]

Uniprot Description

ULBP3: Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP2. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. Has lower affinity for NKG2D compared to ULBP1 and ULBP2 and induces weaker signaling responses than does ULBP2 or ULBP1. Belongs to the MHC class I family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 6q25

Cellular Component: anchored to plasma membrane; plasma membrane

Molecular Function: antigen binding; natural killer cell lectin-like receptor binding

Biological Process: antigen processing and presentation; natural killer cell activation; natural killer cell mediated cytotoxicity; regulation of immune response

Research Articles on ULBP-3

Similar Products

Product Notes

The ULBP-3 ulbp3 (Catalog #AAA9141792) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GRADAHSLWY NFTIIHLPRH GQQWCEVQSQ VDQKNFLSYD CGSDKVLSMG HLEEQLYATD AWGKQLEMLR EVGQRLRLEL ADTELEDFTP SGPLTLQVRM SCECEADGYI RGSWQFSFDG RKFLLFDSNN RKWTVVHAGA RRMKEKWEKD SGLTTFFKMV SMRDCKSWLR DFLMHRKKRL EPTAPPTMAP. It is sometimes possible for the material contained within the vial of "ULBP-3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.