SDS-Page
(Recombinant Human ULBP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-65 kDa.)
ULBP2 recombinant protein
Recombinant Human ULBP2 Protein
Gene Names
ULBP2; N2DL2; RAET1H; RAET1L; NKG2DL2; ALCAN-alpha
Purity
>92% by SDS-PAGE.
Synonyms
ULBP2; Recombinant Human ULBP2 Protein; ALCAN-alpha; N2DL2; NKG2DL2; RAET1H; UNQ463 / PRO791; ULBP2 recombinant protein
Host
HEK293 Cells
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
Sequence Length
246
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human ULBP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-65 kDa.)
SDS-Page
(Recombinant Human ULBP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-65 kDa.)
Related Product Information for ULBP2 recombinant protein
Description: Recombinant Human ULBP2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly26-Ser217) of human ULBP2 (Accession #NP_079493.1) fused with an Fc, 6xHis tag at the C-terminus.
Background: ULBP2 Protein, Human, Recombinant (His Tag) consists of 203 amino acids with a molecular weight of 23.2 kDa. The apparent molecular mass of recombinant human ULBP2 is about 33 kDa in SDS-PAGE under reducing conditions because of glycosylation.NKG2D ligand 2 is cell membrane protein belonging to theMHC class I family.The gene for ULBP-2 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. ULBPs are known to bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, gamma delta T cells, and CD8+ alpha beta T cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway.ULBP2 / N2DL-2 is not expressed in normal tissues, but in various types of cancer cell lines and the fetus and has been implicated in tumor surveillance.
Background: ULBP2 Protein, Human, Recombinant (His Tag) consists of 203 amino acids with a molecular weight of 23.2 kDa. The apparent molecular mass of recombinant human ULBP2 is about 33 kDa in SDS-PAGE under reducing conditions because of glycosylation.NKG2D ligand 2 is cell membrane protein belonging to theMHC class I family.The gene for ULBP-2 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. ULBPs are known to bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, gamma delta T cells, and CD8+ alpha beta T cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway.ULBP2 / N2DL-2 is not expressed in normal tissues, but in various types of cancer cell lines and the fetus and has been implicated in tumor surveillance.
Product Categories/Family for ULBP2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
ULBP2
NCBI Official Synonym Full Names
UL16 binding protein 2
NCBI Official Symbol
ULBP2
NCBI Official Synonym Symbols
N2DL2; RAET1H; RAET1L; NKG2DL2; ALCAN-alpha
NCBI Protein Information
UL16-binding protein 2
UniProt Protein Name
NKG2D ligand 2
Protein Family
UniProt Gene Name
ULBP2
UniProt Synonym Gene Names
N2DL2; RAET1H; N2DL-2; NKG2DL2
UniProt Entry Name
N2DL2_HUMAN
NCBI Description
This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells. The encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosylphosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells. This gene is located in a cluster of multiple MHC class I-related genes on chromosome 6. [provided by RefSeq, Jul 2015]
Research Articles on ULBP2
Similar Products
Product Notes
The ULBP2 ulbp2 (Catalog #AAA9141816) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GRADPHSLCY DITVIPKFRP GPRWCAVQGQ VDEKTFLHYD CGNKTVTPVS PLGKKLNVTT AWKAQNPVLR EVVDILTEQL RDIQLENYTP KEPLTLQARM SCEQKAEGHS SGSWQFSFDG QIFLLFDSEK RMWTTVHPGA RKMKEKWEND KVVAMSFHYF SMGDCIGWLE DFLMGMDSTL EPSAGAPLAM SS. It is sometimes possible for the material contained within the vial of "ULBP2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
