Transient receptor potential cation channel subfamily M member 6 (TRPM6) Recombinant Protein | TRPM6 recombinant protein

Recombinant Human Transient receptor potential cation channel subfamily M member 6 (TRPM6) , partial

Cat. Num. AAA7098517

• Gene Names: TRPM6; HSH; HMGX; HOMG; CHAK2; HOMG1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transient receptor potential cation channel subfamily M member 6 (TRPM6); Recombinant Human Transient receptor potential cation channel subfamily M member 6 (TRPM6); partial; TRPM6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1747-1893. Partial
• Sequence: SPLNLDKSMSSWSQRGRAAMIQVLSREEMDGGLRKAMRVVSTWSEDDILKPGQVFIVKSFLPEVVRTWHKIFQESTVLHLCLREIQQQRAAQKLIYTFNQVKPQTIPYTPRFLEVFLIYCHSANQWLTIEKYMTGEFRKYNNNNGDE

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 293597572
• NCBI GeneID: 140803
• NCBI Accession #: NP_001170781.1
• NCBI GenBank Nucleotide #: NM_001177310.1
• UniProt Accession #: Q9BX84; Q6VPR8; Q6VPR9; Q6VPS0; Q6VPS1; Q6VPS2
• Molecular Weight: 65,083 Da
• NCBI Official Full Name: transient receptor potential cation channel subfamily M member 6 isoform b
• NCBI Official Synonym Full Names: transient receptor potential cation channel subfamily M member 6
• NCBI Official Symbol: TRPM6
• NCBI Official Synonym Symbols: HSH; HMGX; HOMG; CHAK2; HOMG1
• NCBI Protein Information: transient receptor potential cation channel subfamily M member 6
• UniProt Protein Name: Transient receptor potential cation channel subfamily M member 6
• Protein Family: Transient receptor potential cation channel subfamily
• UniProt Gene Name: TRPM6
• UniProt Synonym Gene Names: CHAK2

NCBI Description

This gene is predominantly expressed in the kidney and colon, and encodes a protein containing an ion channel domain and a protein kinase domain. It is crucial for magnesium homeostasis, and plays an essential role in epithelial magnesium transport and in the active magnesium absorption in the gut and kidney. Mutations in this gene are associated with hypomagnesemia with secondary hypocalcemia. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Apr 2010]

Uniprot Description

Essential ion channel and serine/threonine-protein kinase. Crucial for magnesium homeostasis. Has an important role in epithelial magnesium transport and in the active magnesium absorption in the gut and kidney. Isoforms of the type M6-kinase lack the ion channel region.