Tripeptidyl-peptidase 1 (TPP1) Recombinant Protein | TPP1 recombinant protein
Recombinant Dog Tripeptidyl-peptidase 1 (TPP1)
Gene Names
TPP1; CLN2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tripeptidyl-peptidase 1 (TPP1); Recombinant Dog Tripeptidyl-peptidase 1 (TPP1); TPP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
196-563, Full length protein
Sequence
LHLGVTPSVIRQRYNLTAQDVGSGTTNNSQACAQFLEQYFHASDLAEFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVEYLMSAGANISTWVYSSPGRHESQEPFLQWLLLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTEFMKAAARGLTLLFASGDSGAGCWSVSRRHQFRPSFPASSPYVTTVGGTSFQNPFRVTTEIVDYISGGGFSNVFPQPSYQEEAVVQFLSSSPHLPPSSYFNASGRAYPDVAALSDGYWVVSNSVPIPWVSGTSASTPVFGGILSLINEHRLLSGLPPLGFLNPRLYQQRGAGLFDVTRGCHESCLNEEVQGQGFCSGPGWDPVTGWGTPNFPALLKALIKP
Sequence Length
368
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TPP1 recombinant protein
This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61,362 Da
NCBI Official Full Name
tripeptidyl-peptidase 1
NCBI Official Synonym Full Names
tripeptidyl peptidase 1
NCBI Official Symbol
TPP1
NCBI Official Synonym Symbols
CLN2
NCBI Protein Information
tripeptidyl-peptidase 1
UniProt Protein Name
Tripeptidyl-peptidase 1
Protein Family
UniProt Gene Name
TPP1
UniProt Synonym Gene Names
CLN2; TPP-1; LPIC; TPP-I
Uniprot Description
Lysosomal serine protease with tripeptidyl-peptidase I activity. May act as a non-specific lysosomal peptidase which generates tripeptides from the breakdown products produced by lysosomal proteinases. Requires substrates with an unsubstituted N-terminus ().
Research Articles on TPP1
Similar Products
Product Notes
The TPP1 tpp1 (Catalog #AAA1357909) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 196-563, Full length protein. The amino acid sequence is listed below: LHLGVTPSVI RQRYNLTAQD VGSGTTNNSQ ACAQFLEQYF HASDLAEFMR LFGGNFAHQA SVARVVGQQG RGRAGIEASL DVEYLMSAGA NISTWVYSSP GRHESQEPFL QWLLLLSNES ALPHVHTVSY GDDEDSLSSA YIQRVNTEFM KAAARGLTLL FASGDSGAGC WSVSRRHQFR PSFPASSPYV TTVGGTSFQN PFRVTTEIVD YISGGGFSNV FPQPSYQEEA VVQFLSSSPH LPPSSYFNAS GRAYPDVAAL SDGYWVVSNS VPIPWVSGTS ASTPVFGGIL SLINEHRLLS GLPPLGFLNP RLYQQRGAGL FDVTRGCHES CLNEEVQGQG FCSGPGWDPV TGWGTPNFPA LLKALIKP. It is sometimes possible for the material contained within the vial of "Tripeptidyl-peptidase 1 (TPP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
