SDS-PAGE
Toll-like receptor 10 (TLR10) Recombinant Protein | TLR10 recombinant protein
Recombinant Human Toll-like receptor 10 (TLR10), partial
Gene Names
TLR10; CD290
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Toll-like receptor 10 (TLR10); Recombinant Human Toll-like receptor 10 (TLR10); partial; CD_antigen: CD290; TLR10 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
20-576aa; Partial-length
Sequence
DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMRTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNILTDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWPETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNT
Species
Homo sapiens(Human)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for TLR10 recombinant protein
Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity)
Product Categories/Family for TLR10 recombinant protein
References
"The heterogeneous allelic repertoire of human Toll-Like receptor (TLR) genes."Georgel P., Macquin C., Bahram S.PLoS ONE 4:E7803-E7803(2009)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
68.1 kDa
NCBI Official Full Name
toll-like receptor 10 isoform a
NCBI Official Synonym Full Names
toll like receptor 10
NCBI Official Symbol
TLR10
NCBI Official Synonym Symbols
CD290
NCBI Protein Information
toll-like receptor 10
UniProt Protein Name
Toll-like receptor 10
Protein Family
UniProt Gene Name
TLR10
NCBI Description
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is most highly expressed in lymphoid tissues such as spleen, lymph node, thymus, and tonsil. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. [provided by RefSeq, Aug 2010]
Uniprot Description
Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response ().
Research Articles on TLR10
Similar Products
Product Notes
The TLR10 tlr10 (Catalog #AAA7053537) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-576aa; Partial-length. The amino acid sequence is listed below: DAPELPEERE LMTNCSNMSL RKVPADLTPA TTTLDLSYNL LFQLQSSDFH SVSKLRVLIL CHNRIQQLDL KTFEFNKELR YLDLSNNRLK SVTWYLLAGL RYLDLSFNDF DTMPICEEAG NMSHLEILGL SGAKIQKSDF QKIAHLHLNT VFLGFRTLPH YEEGSLPILN TTKLHIVLPM DTNFWVLLRD GIKTSKILEM TNIDGKSQFV SYEMQRNLSL ENAKTSVLLL NKVDLLWDDL FLILQFVWHT SVEHFQIRNV TFGGKAYLDH NSFDYSNTVM RTIKLEHVHF RVFYIQQDKI YLLLTKMDIE NLTISNAQMP HMLFPNYPTK FQYLNFANNI LTDELFKRTI QLPHLKTLIL NGNKLETLSL VSCFANNTPL EHLDLSQNLL QHKNDENCSW PETVVNMNLS YNKLSDSVFR CLPKSIQILD LNNNQIQTVP KETIHLMALR ELNIAFNFLT DLPGCSHFSR LSVLNIEMNF ILSPSLDFVQ SCQEVKTLNA GRNPFRCTCE LKNFIQLETY SEVMMVGWSD SYTCEYPLNL RGTRLKDVHL HELSCNT. It is sometimes possible for the material contained within the vial of "Toll-like receptor 10 (TLR10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
