Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Sulfotransferase family cytosolic 1B member 1 (Sult1b1) Recombinant Protein | Sult1b1 recombinant protein

Recombinant Rat Sulfotransferase family cytosolic 1B member 1 (Sult1b1)

Gene Names
Sult1b1; ST1B1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfotransferase family cytosolic 1B member 1 (Sult1b1); Recombinant Rat Sulfotransferase family cytosolic 1B member 1 (Sult1b1); Sulfotransferase family cytosolic 1B member 1; ST1B1; Sulfotransferase 1B1; EC=2.8.2.-; DOPA/tyrosine sulfotransferase; Sult1b1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-299aa; Full Length
Sequence
MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA
Sequence Length
299
Species
Rattus norvegicus (Rat)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page
Related Product Information for Sult1b1 recombinant protein
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. sulfonation of DOPA, tyrosine isomers and thyroid hormones such as 3,3',5-triiodothyronine and 3,3'-diiodothyronine. May play a role in the limitation of the production of L-DOPA and L-m-tyrosine and also in facilitating their excretion.
Product Categories/Family for Sult1b1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54.8 kDa
NCBI Official Full Name
sulfotransferase family cytosolic 1B member 1
NCBI Official Synonym Full Names
sulfotransferase family, cytosolic, 1B, member 1
NCBI Official Symbol
Sult1b1
NCBI Official Synonym Symbols
ST1B1
NCBI Protein Information
sulfotransferase family cytosolic 1B member 1; sulfotransferase 1B1; dopa/tyrosine sulfotransferase; sulfotransferase family 1B, member 1
UniProt Protein Name
Sulfotransferase family cytosolic 1B member 1
UniProt Gene Name
Sult1b1
UniProt Synonym Gene Names
St1b1; ST1B1; Sulfotransferase 1B1
UniProt Entry Name
ST1B1_RAT

NCBI Description

an enzyme which catalyzes the transfer of sufate groups onto various tyrosine and 3,4-dihydroxyphenylalanine (Dopa) isomers [RGD, Feb 2006]

Uniprot Description

SULT1B1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine. Belongs to the sulfotransferase 1 family.

Protein type: EC 2.8.2.-; Transferase

Cellular Component: cytosol

Molecular Function: sulfotransferase activity; aryl sulfotransferase activity

Biological Process: steroid metabolic process; epithelial cell differentiation; flavonoid metabolic process; xenobiotic metabolic process; sulfation; thyroid hormone metabolic process; phenol metabolic process

Research Articles on Sult1b1

Similar Products

Product Notes

The Sult1b1 sult1b1 (Catalog #AAA718895) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-299aa; Full Length. The amino acid sequence is listed below: MGTAEDVFRK DLKIIHGYPM VYAFALGWEK IEEFQSRPCD IVIPTYPKSG TTWLSEIVDM VLNDGNVEKC KRDVITSKVP MLEQNVPGAR RSGVELLKKT PSPRIIKTHL PIDLLPKSFW DNKCKMIYLA RNGKDVAVSY YHFDLMNNIQ PLPGTWEEYL EKFLAGNVAY GSWFDHVKSW WEKREGHPIL FLYYEDLKKN PKKEIKKIAN FLDKTLDEHT LERIVHHTSF EVMKDNPLVN YTHLPTEIMD HSKSPFMRKG VVGDWKNYFT MTQSEKFDAI YKKKLSGTTL EFCTDIQSA. It is sometimes possible for the material contained within the vial of "Sulfotransferase family cytosolic 1B member 1 (Sult1b1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.