Mouse anti-Human ZNF501 Polyclonal Antibody | anti-ZNF501 antibody

ZNF501 (Zinc Finger Protein 501, Zinc Finger Protein 52, ZNF52)

Cat. Num. AAA6003658

• Gene Names: ZNF501; ZNF; ZNF52
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF501; Polyclonal Antibody; ZNF501 (Zinc Finger Protein 501; Zinc Finger Protein 52; ZNF52); Anti -ZNF501 (Zinc Finger Protein 501; anti-ZNF501 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF501.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MKHGRVNMQKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCSECGSCFRKQSNLTQHLRIHTGEKPYKCNECEKAFQTKAILVQHLRIHTGEKPYKCNECGKAFCQSPSLIKHQRIHTGEKPYKCTECGKAFSQSICLTRHQRSHSGDKPFKCNECGKAFNQSACLMQHQRIHSGEKPYTCTECGKAFTQNSSLVEHERTHTGEKLYKCSECEKTFRKQAHLSEHYRIHTGEKPYECVGCGKSFRHSSALLRHQRLHAGE

• Applicable Applications for anti-ZNF501 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human ZNF501, aa1-262.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNF501 expression in transfected 293T cell line by ZNF501 polyclonal antibody. Lane 1: ZNF501 transfected lysate (28.82kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF501 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-ZNF501 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 384871699
• NCBI GeneID: 115560
• NCBI Accession #: NP_001245209.1
• NCBI GenBank Nucleotide #: NM_001258280.1
• UniProt Accession #: Q96CX3; Q96NU9; B4DLY7
• Molecular Weight: 31,179 Da
• NCBI Official Full Name: zinc finger protein 501
• NCBI Official Synonym Full Names: zinc finger protein 501
• NCBI Official Symbol: ZNF501
• NCBI Official Synonym Symbols: ZNF; ZNF52
• NCBI Protein Information: zinc finger protein 501; zinc finger protein 52
• UniProt Protein Name: Zinc finger protein 501
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZNF501
• UniProt Synonym Gene Names: ZNF52
• UniProt Entry Name: ZN501_HUMAN

Uniprot Description

ZNF501: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent