Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Glucagon-like peptide 1 receptor Recombinant Protein | Glp1r recombinant protein

Recombinant Mouse Glucagon-like peptide 1 receptor

Gene Names
Glp1r; GLP-1R; GLP1Rc
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glucagon-like peptide 1 receptor; Recombinant Mouse Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-145aa; Partial
Sequence
GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Species
Mus musculus (Mouse)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for Glp1r recombinant protein
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Product Categories/Family for Glp1r recombinant protein
References
"Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene." Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F. Diabetes 47:646-652(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.4 kDa
NCBI Official Full Name
glucagon-like peptide 1 receptor
NCBI Official Synonym Full Names
glucagon-like peptide 1 receptor
NCBI Official Symbol
Glp1r
NCBI Official Synonym Symbols
GLP-1R; GLP1Rc
NCBI Protein Information
glucagon-like peptide 1 receptor
UniProt Protein Name
Glucagon-like peptide 1 receptor
UniProt Gene Name
Glp1r
UniProt Synonym Gene Names
GLP-1 receptor; GLP-1-R; GLP-1R
UniProt Entry Name
GLP1R_MOUSE

Uniprot Description

GLP1R: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 2

Cellular Component: cytosol; integral to membrane; integral to plasma membrane; intracellular; membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; glucagon receptor activity; peptide hormone binding; peptide receptor activity; peptide receptor activity, G-protein coupled; receptor activity; signal transducer activity; transmembrane receptor activity

Biological Process: associative learning; cAMP-mediated signaling; cell surface receptor linked signal transduction; elevation of cytosolic calcium ion concentration; feeding behavior; G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase activating pathway; hormone secretion; insulin secretion; learning and/or memory; memory; negative regulation of apoptosis; negative regulation of neuron apoptosis; neuropeptide signaling pathway; positive regulation of blood pressure; positive regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of heart contraction; positive regulation of insulin secretion; positive regulation of transcription from RNA polymerase II promoter; regulation of calcium ion transport; regulation of heart contraction; release of sequestered calcium ion into cytosol; response to glucose stimulus; response to stress; signal transduction

Research Articles on Glp1r

Similar Products

Product Notes

The Glp1r glp1r (Catalog #AAA1246635) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-145aa; Partial. The amino acid sequence is listed below: GPRPQGTTVS LSETVQKWRE YRRQCQRFLT EAPLLATGLF CNRTFDDYAC WPDGPPGSFV NVSCPWYLPW ASSVLQGHVY RFCTAEGLWL HKDNSSLPWR DLSECEESKR GERNFPEEQL LSLY . It is sometimes possible for the material contained within the vial of "Glucagon-like peptide 1 receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.