Arylacetamide deacetylase (AADAC) Recombinant Protein | AADAC recombinant protein

Recombinant Human Arylacetamide deacetylase (AADAC), partial

Cat. Num. AAA963291

• Gene Names: AADAC; DAC; CES5A1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Arylacetamide deacetylase (AADAC); Recombinant Human Arylacetamide deacetylase (AADAC); partial; Arylacetamide deacetylase; EC=3.1.1.3; AADAC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-399aa; Partial
• Sequence: PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for AADAC recombinant protein

Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.

NCBI and Uniprot Product Information

• NCBI GI #: 68299767
• NCBI GeneID: 13
• NCBI Accession #: NP_001077.2
• NCBI GenBank Nucleotide #: NM_001086.2
• UniProt Accession #: P22760; Q8N1A9; A8K3L3; D3DNJ6
• Molecular Weight: 45.6
• NCBI Official Full Name: arylacetamide deacetylase
• NCBI Official Synonym Full Names: arylacetamide deacetylase
• NCBI Official Symbol: AADAC
• NCBI Official Synonym Symbols: DAC; CES5A1
• NCBI Protein Information: arylacetamide deacetylase; arylacetamide deacetylase (esterase)
• UniProt Protein Name: Arylacetamide deacetylase
• Protein Family: Arylacetamide deacetylase
• UniProt Gene Name: AADAC
• UniProt Synonym Gene Names: DAC
• UniProt Entry Name: AAAD_HUMAN

NCBI Description

Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008]

Uniprot Description

AADAC: Arylacetamide deacetylation is an important enzyme activity in the metabolic activation of arylamine substrates to ultimate carcinogens. Displays major serine hydrolase activity in liver microsomes. Hydrolyzes also flutamide, which is an antiandrogen drug used for the treatment of prostate cancer that occasionaly causes severe hepatotoxicity. Displays cellular triglyceride lipase activity in liver. Increases intracellular fatty acids derived from hydrolysis of newly formed triglyceride stores. Belongs to the 'GDXG' lipolytic enzyme family.

Protein type: Endoplasmic reticulum; Motility/polarity/chemotaxis; Membrane protein, integral; Deacetylase; EC 3.1.1.3; Lipase

Chromosomal Location of Human Ortholog: 3q25.1

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: deacetylase activity; triacylglycerol lipase activity; serine hydrolase activity; lipase activity; catalytic activity

Biological Process: metabolic process