Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNA translocase SpoIIIE (spoIIIE) Recombinant Protein | spoIIIE recombinant protein

Recombinant Bacillus subtilis DNA translocase SpoIIIE (spoIIIE)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA translocase SpoIIIE (spoIIIE); Recombinant Bacillus subtilis DNA translocase SpoIIIE (spoIIIE); spoIIIE recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-787aa; full length protein
Sequence
MAKKKRKSRKKQAKQLNIKYELNGLLCIAISIIAILQLGVVGQTFIYLFRFFAGEWFILC LLGLLVLGVSLFWKKKTPSLLTRRKAGLYCIIASILLLSHVQLFKNLTHKGSIESASVVR NTWELFLMDMNGSSASPDLGGGMIGALLFAASHFLFASTGSQIMAIVMILIGMILVTGRS LQETLKKWMSPIGRFIKEQWLAFIDDMKSFKSNMQSSKKTKAPSKKQKPARKKQQMEPEP PDEEGDYETVSPLIHSEPIISSFSDRNEEEESPVIEKRAEPVSKPLQDIQPETGDQETVS APPMTFTELENKDYEMPSLDLLADPKHTGQQADKKNIYENARKLERTFQSFGVKAKVTQV HLGPAVTKYEVYPDVGVKVSKIVNLSDDLALALAAKDIRIEAPIPGKSAIGIEVPNAEVA MVSLKEVLESKLNDRPDAKLLIGLGRNISGEAVLAELNKMPHLLVAGATGSGKSVCVNGI ITSILMRAKPHEVKMMMIDPKMVELNVYNGIPHLLAPVVTDPKKASQALKKVVNEMERRY ELFSHTGTRNIEGYNDYIKRANNEEGAKQPELPYIVVIVDELADLMMVASSDVEDSITRL SQMARAAGIHLIIATQRPSVDVITGVIKANIPSRIAFSVSSQTDSRTILDMGGAEKLLGR GDMLFLPVGANKPVRVQGAFLSDDEVEKVVDHVITQQKAQYQEEMIPEETTETHSEVTDE LYDEAVELIVGMQTASVSMLQRRFRIGYTRAARLIDAMEERGVVGPYEGSKPREVLLSKE KYDELSS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for spoIIIE recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,181 Da
NCBI Official Full Name
MULTISPECIES: DNA translocase SpoIIIE
UniProt Protein Name
DNA translocase SpoIIIE
Protein Family
UniProt Gene Name
spoIIIE
UniProt Synonym Gene Names
ftsK
UniProt Entry Name
SP3E_BACSU

Uniprot Description

Plays an essential role during sporulation. Required for the translocation of the chromosomal DNA from mother cell into the forespore during polar septation, for the final steps of compartmentalization in the presence of trapped DNA, and for the final steps of engulfment. The N-terminus mediates localization to the division septum and is required for both septal membrane fusion and engulfment membrane fusion. May form DNA-conducting channels across the two lipid bilayers of the septum after cell division. The C-terminus functions as a DNA motor that exports DNA in an ATP-dependent manner from mother cell into the forespore. DNA-binding proteins are stripped off the chromosome during translocation, which may play a key role in reprogramming developmental gene expression in the forespore. The two arms of the chromosome are simultaneously pumped into the forespore, which suggests that the septum contains at least two channels, one for each arm. Required for separation of chromosome termini. Also required for optimal chromosome partitioning in vegetative cells, by actively moving chromosomal DNA trapped within the division septum into the daughter cells.

Similar Products

Product Notes

The spoIIIE spoiiie (Catalog #AAA7030306) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-787aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the spoIIIE spoiiie for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAKKKRKSRK KQAKQLNIKY ELNGLLCIAI SIIAILQLGV VGQTFIYLFR FFAGEWFILC LLGLLVLGVS LFWKKKTPSL LTRRKAGLYC IIASILLLSH VQLFKNLTHK GSIESASVVR NTWELFLMDM NGSSASPDLG GGMIGALLFA ASHFLFASTG SQIMAIVMIL IGMILVTGRS LQETLKKWMS PIGRFIKEQW LAFIDDMKSF KSNMQSSKKT KAPSKKQKPA RKKQQMEPEP PDEEGDYETV SPLIHSEPII SSFSDRNEEE ESPVIEKRAE PVSKPLQDIQ PETGDQETVS APPMTFTELE NKDYEMPSLD LLADPKHTGQ QADKKNIYEN ARKLERTFQS FGVKAKVTQV HLGPAVTKYE VYPDVGVKVS KIVNLSDDLA LALAAKDIRI EAPIPGKSAI GIEVPNAEVA MVSLKEVLES KLNDRPDAKL LIGLGRNISG EAVLAELNKM PHLLVAGATG SGKSVCVNGI ITSILMRAKP HEVKMMMIDP KMVELNVYNG IPHLLAPVVT DPKKASQALK KVVNEMERRY ELFSHTGTRN IEGYNDYIKR ANNEEGAKQP ELPYIVVIVD ELADLMMVAS SDVEDSITRL SQMARAAGIH LIIATQRPSV DVITGVIKAN IPSRIAFSVS SQTDSRTILD MGGAEKLLGR GDMLFLPVGA NKPVRVQGAF LSDDEVEKVV DHVITQQKAQ YQEEMIPEET TETHSEVTDE LYDEAVELIV GMQTASVSML QRRFRIGYTR AARLIDAMEE RGVVGPYEGS KPREVLLSKE KYDELSS. It is sometimes possible for the material contained within the vial of "DNA translocase SpoIIIE (spoIIIE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.