Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human FGF-9 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 25 kDa.)

FGF-9 recombinant protein

Recombinant Human FGF-9 Protein

Gene Names
FGF9; GAF; FGF-9; SYNS3; HBFG-9; HBGF-9
Purity
>95% by SDS-PAGE.
Synonyms
FGF-9; Recombinant Human FGF-9 Protein; GAF; HBFG-9; HBGF-9; SYNS3; FGF-9 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Sequence
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Sequence Length
208
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human FGF-9 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 25 kDa.)

SDS-Page (Recombinant protein Human FGF-9 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 25 kDa.)
Related Product Information for FGF-9 recombinant protein
Description: Recombinant Human FGF-9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser208) of human FGF-9 (Accession #P31371).

Background: This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis.
Product Categories/Family for FGF-9 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
fibroblast growth factor 9
NCBI Official Synonym Full Names
fibroblast growth factor 9
NCBI Official Symbol
FGF9
NCBI Official Synonym Symbols
GAF; FGF-9; SYNS3; HBFG-9; HBGF-9
NCBI Protein Information
fibroblast growth factor 9
UniProt Protein Name
Fibroblast growth factor 9
UniProt Gene Name
FGF9
UniProt Synonym Gene Names
FGF-9; GAF; HBGF-9
UniProt Entry Name
FGF9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF9: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Defects in FGF9 are the cause of multiple synostoses syndrome type 3 (SYNS3). Multiple synostoses syndrome is an autosomal dominant condition characterized by progressive joint fusions of the fingers, wrists, ankles and cervical spine, characteristic facies and progressive conductive deafness. Belongs to the heparin-binding growth factors family.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 13q11-q12

Cellular Component: extracellular space; cytoplasm; extracellular region; basement membrane

Molecular Function: heparin binding; growth factor activity; fibroblast growth factor receptor binding

Biological Process: negative regulation of Wnt receptor signaling pathway; nerve growth factor receptor signaling pathway; embryonic skeletal development; negative regulation of transcription from RNA polymerase II promoter; signal transduction; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of activin receptor signaling pathway; substantia nigra development; positive regulation of MAPKKK cascade; cell-cell signaling; protein import into nucleus; male sex determination; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; chondrocyte differentiation; positive regulation of smoothened signaling pathway; angiogenesis; embryonic gut development; regulation of timing of cell differentiation; embryonic limb morphogenesis; positive regulation of cardiac muscle cell proliferation; epidermal growth factor receptor signaling pathway; inner ear morphogenesis; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; male gonad development; osteoblast differentiation; positive regulation of cell division; insulin receptor signaling pathway; innate immune response; positive regulation of epithelial cell proliferation

Disease: Multiple Synostoses Syndrome 3

Research Articles on FGF-9

Similar Products

Product Notes

The FGF-9 fgf9 (Catalog #AAA9139803) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MAPLGEVGNY FGVQDAVPFG NVPVLPVDSP VLLSDHLGQS EAGGLPRGPA VTDLDHLKGI LRRRQLYCRT GFHLEIFPNG TIQGTRKDHS RFGILEFISI AVGLVSIRGV DSGLYLGMNE KGELYGSEKL TQECVFREQF EENWYNTYSS NLYKHVDTGR RYYVALNKDG TPREGTRTKR HQKFTHFLPR PVDPDKVPEL YKDILSQS. It is sometimes possible for the material contained within the vial of "FGF-9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.