Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

30S ribosomal protein S3 Recombinant Protein | rpsC recombinant protein

Recombinant E Coli 30S ribosomal protein S3

Gene Names
rpsC; ECK3301; JW3276
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
30S ribosomal protein S3; Recombinant E Coli 30S ribosomal protein S3; rpsC recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-233aa; Full Length
Sequence
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
Sequence Length
233
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for rpsC recombinant protein
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation. Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp.
References
Structure of the Escherichia coli S10 ribosomal protein operon.Zurawski G., Zurawski S.M.Nucleic Acids Res. 13:4521-4526(1985) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) The primary structure of protein S3 from the small ribosomal subunit of Escherichia coli.Brauer D., Roming R.FEBS Lett. 106:352-357(1979) Protein-rRNA binding features and their structural and functional implications in ribosomes as determined by cross-linking studies.Urlaub H., Kruft V., Bischof O., Mueller E.-C., Wittmann-Liebold B.EMBO J. 14:4578-4588(1995) Flexibility of the nascent polypeptide chain within the ribosome --contacts from the peptide N-terminus to a specific region of the 30S subunit.Choi K.M., Atkins J.F., Gesteland R.F., Brimacombe R.Eur. J. Biochem. 255:409-413(1998) mRNA helicase activity of the ribosome.Takyar S., Hickerson R.P., Noller H.F.Cell 120:49-58(2005) Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999) All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002) Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003) Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52.9 kDa
NCBI Official Full Name
30S ribosomal subunit protein S3
NCBI Official Symbol
rpsC
NCBI Official Synonym Symbols
ECK3301; JW3276
NCBI Protein Information
30S ribosomal subunit protein S3
UniProt Protein Name
30S ribosomal protein S3
Protein Family
UniProt Gene Name
rpsC
UniProt Entry Name
RS3_ECOLI

NCBI Description

The S3 protein, a component of the small subunit of the ribosome, is surface-accessible and located on the head of the 30S subunit . [More information is available at EcoCyc: EG10902].

Uniprot Description

Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation ().

Research Articles on rpsC

Similar Products

Product Notes

The rpsC rpsc (Catalog #AAA717304) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-233aa; Full Length. The amino acid sequence is listed below: GQKVHPNGIR LGIVKPWNST WFANTKEFAD NLDSDFKVRQ YLTKELAKAS VSRIVIERPA KSIRVTIHTA RPGIVIGKKG EDVEKLRKVV ADIAGVPAQI NIAEVRKPEL DAKLVADSIT SQLERRVMFR RAMKRAVQNA MRLGAKGIKV EVSGRLGGAE IARTEWYREG RVPLHTLRAD IDYNTSEAHT TYGVIGVKVW IFKGEILGGM AAVEQPEKPA AQPKKQQRKG RK. It is sometimes possible for the material contained within the vial of "30S ribosomal protein S3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.