30S ribosomal protein S13 Recombinant Protein | rpsM recombinant protein

Recombinant E Coli 30S ribosomal protein S13

Cat. Num. AAA717380

• Gene Names: rpsM; ECK3285; JW3260
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 30S ribosomal protein S13; Recombinant E Coli 30S ribosomal protein S13; rpsM recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-118aa; Full Length
• Sequence: ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
• Sequence Length: 118

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for rpsM recombinant protein

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.

References

Nucleotide sequence of the alpha ribosomal protein operon of Escherichia coli.Bedwell D.M., Davis G.R., Gosink M., Post L.E., Nomura M., Kestler H., Zengel J.M., Lindahl L.Nucleic Acids Res. 13:3891-3903(1985) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Primary structure of protein S13 from the small subunit of Escherichia coli ribosomes.Lindemann H., Wittmann-Liebold B.Hoppe-Seyler's Z. Physiol. Chem. 358:843-863(1977) DNA sequence of the promoter region for the alpha ribosomal protein operon in Escherichia coli.Post L.E., Arfsten A.E., Davis G.R., Nomura M.J. Biol. Chem. 255:4653-4659(1980) Growth-rate-dependent regulation of ribosome synthesis in E. coli expression of the lacZ and galK genes fused to ribosomal promoters.Miura A., Krueger J.H., Itoh S., de Boer H.A., Nomura M.Cell 25:773-782(1981) Identification of a cross-link in the Escherichia coli ribosomal protein pair S13-S19 at the amino acid level.Pohl T., Wittmann-Liebold B.J. Biol. Chem. 263:4293-4301(1988) Antisuppression by a mutation in rpsM(S13) giving a shortened ribosomal protein S13.Faxen M., Walles-Granberg A., Isaksson L.A.Biochim. Biophys. Acta 1218:27-34(1994) The ribosomal neighbourhood of the central fold of tRNA cross-links from position 47 of tRNA located at the A, P or E site.Osswald M., Doering T., Brimacombe R.Nucleic Acids Res. 23:4635-4641(1995) A novel ribosome-associated protein is important for efficient translation in Escherichia coli.Bylund G.O., Persson B.C., Lundberg L.A., Wikstroem P.M.J. Bacteriol. 179:4567-4574(1997) Creating ribosomes with an all-RNA 30S subunit P site.Hoang L., Fredrick K., Noller H.F.Proc. Natl. Acad. Sci. U.S.A. 101:12439-12443(2004) Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999) All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002) Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003) Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005) Locking and unlocking of ribosomal motions.Valle M., Zavialov A., Sengupta J., Rawat U., Ehrenberg M., Frank J.Cell 114:123-134(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 16131177
• NCBI GeneID: 947791
• NCBI Accession #: NP_417757.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0A7S9; P02369; Q2M6W3
• Molecular Weight: 40 kDa
• NCBI Official Full Name: 30S ribosomal subunit protein S13
• NCBI Official Symbol: rpsM
• NCBI Official Synonym Symbols: ECK3285; JW3260
• NCBI Protein Information: 30S ribosomal subunit protein S13
• UniProt Protein Name: 30S ribosomal protein S13
• Protein Family: 30S ribosomal protein
• UniProt Gene Name: rpsM
• UniProt Entry Name: RS13_ECOLI

NCBI Description

rpsM can be deleted, but null mutants grow slowly and express kanamycin resistance weakly (Bubunenko, 2007), which may explain why a deletion was not isolated by Baba (2006), leading to its misclassification as an essential gene. [More information is available at EcoGene: EG10912]. The S13 protein is a component of the 30S subunit of the ribosome, playing a key role in subunit association and the fidelity of translocation. [More information is available at EcoCyc: EG10912].

Uniprot Description

Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.