30S ribosomal protein S8 Recombinant Protein | rpsH recombinant protein

Recombinant E Coli 30S ribosomal protein S8

Cat. Num. AAA1265157

• Gene Names: rpsH; ECK3293; JW3268
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 30S ribosomal protein S8; Recombinant E Coli 30S ribosomal protein S8; rpsH recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-130aa; Full Length
• Sequence: SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
• Sequence Length: 130

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for rpsH recombinant protein

One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit. Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA.

References

The spc ribosomal protein operon of Escherichia coli sequence and cotranscription of the ribosomal protein genes and a protein export gene.Cerretti D.P., Dean D., Davis G.R., Bedwell D.M., Nomura M.Nucleic Acids Res. 11:2599-2616(1983) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) The amino acid sequence of the ribosomal protein S8 of Escherichia coli.Allen G., Wittmann-Liebold B.Hoppe-Seyler's Z. Physiol. Chem. 359:1509-1525(1978) Translational regulation by ribosomal protein S8 in Escherichia coli structural homology between rRNA binding site and feedback target on mRNA.Olins P.O., Nomura M.Nucleic Acids Res. 9:1757-1764(1981) Mutagenesis of ribosomal protein S8 from Escherichia coli defects in regulation of the spc operon.Wower I., Kowaleski M.P., Sears L.E., Zimmermann R.A.J. Bacteriol. 174:1213-1221(1992) Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999) All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002) Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003) Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 16131185
• NCBI GeneID: 947802
• NCBI Accession #: NP_417765.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0A7W7; P02361; Q2M6X1
• Molecular Weight: 18 kDa
• NCBI Official Full Name: 30S ribosomal subunit protein S8
• NCBI Official Symbol: rpsH
• NCBI Official Synonym Symbols: ECK3293; JW3268
• NCBI Protein Information: 30S ribosomal subunit protein S8
• UniProt Protein Name: 30S ribosomal protein S8
• Protein Family: 30S ribosomal protein
• UniProt Gene Name: rpsH
• UniProt Entry Name: RS8_ECOLI

NCBI Description

The S8 protein is a component of the 30S subunit of the ribosome and also functions in the post-transcriptional regulation of the ribosomal protein genes encoded in the spc operon. [More information is available at EcoCyc: EG10907].

Uniprot Description

One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit.