30S ribosomal protein S15 Recombinant Protein | rpsO recombinant protein

Recombinant E Coli 30S ribosomal protein S15

Cat. Num. AAA1265457

• Gene Names: rpsO; ECK3154; JW3134; secC
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 30S ribosomal protein S15; Recombinant E Coli 30S ribosomal protein S15; rpsO recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-89. Full Length of Mature Protein
• Sequence: SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for rpsO recombinant protein

One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. In the E Coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3. 5 A resolved ribosome structures there are minor differences between side-chain conformations.

References

Nucleotide sequence of the gene for Escherichia coli ribosomal protein S15 (rpsO) .Takata R., Mukai T., Aoyagi M., Hori K.Mol. Gen. Genet. 197:225-229(1984) Expression of the rpsO and pnp genes structural analysis of a DNA fragment carrying their control regions.Portier C., Regnier P.Nucleic Acids Res. 12:6091-6102(1984) Promoter activity and transcript mapping in the regulatory region for genes encoding ribosomal protein S15 and polynucleotide phosphorylase of Escherichia coli.Evans S., Dennis P.P.Gene 40:15-22(1985) Nucleotide sequence of the pnp gene of Escherichia coli encoding polynucleotide phosphorylase. Homology of the primary structure of the protein with the RNA-binding domain of ribosomal protein S1.Regnier P., Grunberg-Manago M., Portier C.J. Biol. Chem. 262:63-68(1987) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Primary structure of the 16S rRNA binding protein S15 from Escherichia coli ribosomes.Morinaga T., Funatsu G., Funatsu M., Wittmann H.G.FEBS Lett. 64:307-309(1976) The existence of two genes between infB and rpsO in the Escherichia coli genome DNA sequencing and S1 nuclease mapping.Sands J.F., Regnier P., Cummings H.S., Grunberg-Manago M., Hershey J.W.B.Nucleic Acids Res. 16:10803-10816(1988) Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999) All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002) Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003) Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 16131057
• NCBI GeneID: 947686
• NCBI Accession #: NP_417634.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0ADZ4; P02371; Q2M945
• Molecular Weight: 14.1 kDa
• NCBI Official Full Name: 30S ribosomal subunit protein S15
• NCBI Official Symbol: rpsO
• NCBI Official Synonym Symbols: ECK3154; JW3134; secC
• NCBI Protein Information: 30S ribosomal subunit protein S15
• UniProt Protein Name: 30S ribosomal protein S15
• Protein Family: 30S ribosomal protein
• UniProt Gene Name: rpsO
• UniProt Entry Name: RS15_ECOLI

NCBI Description

The S15 protein is a component of the 30S subunit of the ribosome and also functions in the post-transcriptional regulation of its own expression. [More information is available at EcoCyc: EG10914].

Uniprot Description

One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA (PubMed:12809609, PubMed:16272117). Binds to its own mRNA, stabilizing it 5-UTR and preventing its translation (PubMed:24339747).