SDS-PAGE
Regenerating islet-derived protein 3-gamma Recombinant Protein | Reg3g recombinant protein
Recombinant Rat Regenerating islet-derived protein 3-gamma
Gene Names
Reg3g; Pap3; PAPIII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Regenerating islet-derived protein 3-gamma; Recombinant Rat Regenerating islet-derived protein 3-gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma; Reg3g recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-174aa; Full Length
Sequence
EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA
Sequence Length
174
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Reg3g recombinant protein
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L. monocytogenes and methicillin-resistant S. aureus. Regulates keratinocyte proliferation and differentiation after skin injury.
References
The pancreatitis associated protein III (PAP III)
, a new member of the PAP gene family.Frigerio J.-M., Dusetti N.J., Garrido P., Dagorn J.-C., Iovanna J.L.Biochim. Biophys. Acta 1216:329-331(1993)
Cloning, expression and chromosomal localization of the rat pancreatitis-associated protein III gene.Dusetti N.J., Frigerio J.-M., Szpirer C., Dagorn J.-C., Iovanna J.L.Biochem. J. 307:9-16(1995)
Reg3G gene expression in regenerating skeletal muscle and corresponding nerve.Klasan G.S., Ivanac D., Erzen D.J., Picard A., Takasawa S., Peharec S., Arbanas J., Girotto D., Jerkovic R.Muscle Nerve 49:61-68(2014)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.3 kDa
NCBI Official Full Name
regenerating islet-derived protein 3-gamma
NCBI Official Synonym Full Names
regenerating family member 3 gamma
NCBI Official Symbol
Reg3g
NCBI Official Synonym Symbols
Pap3; PAPIII
NCBI Protein Information
regenerating islet-derived protein 3-gamma
UniProt Protein Name
Regenerating islet-derived protein 3-gamma
Protein Family
UniProt Gene Name
Reg3g
UniProt Synonym Gene Names
Pap3; REG-3-gamma; Reg III-gamma
UniProt Entry Name
REG3G_RAT
Uniprot Description
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury ().
Research Articles on Reg3g
Similar Products
Product Notes
The Reg3g reg3g (Catalog #AAA963651) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-174aa; Full Length. The amino acid sequence is listed below: EDAKEDVPTS RISCPKGSRA YGSYCYALFS VSKSWFDADL ACQKRPSGHL VSVLSGSEAS FVSSLIKSSG NSGQNVWIGL HDPTLGQEPN RGGWEWSNAD VMNYFNWETN PSSVSGSHCG TLTRASGFLR WRENNCISEL PYVCKFKA. It is sometimes possible for the material contained within the vial of "Regenerating islet-derived protein 3-gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
