Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-SPINT1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit SPINT1 Polyclonal Antibody | anti-SPINT1 antibody

SPINT1 antibody - N-terminal region

Gene Names
SPINT1; HAI; HAI1; MANSC2
Reactivity
Cow, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPINT1; Polyclonal Antibody; SPINT1 antibody - N-terminal region; anti-SPINT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGT
Sequence Length
513
Applicable Applications for anti-SPINT1 antibody
Western Blot (WB)
Homology
Cow: 79%; Human: 100%; Pig: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-SPINT1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-SPINT1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-SPINT1 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-SPINT1 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)
Related Product Information for anti-SPINT1 antibody
This is a rabbit polyclonal antibody against SPINT1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured tissues. Alternative splicing results in multiple variants encoding different isoforms.
Product Categories/Family for anti-SPINT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
kunitz-type protease inhibitor 1 isoform 2
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kunitz type 1
NCBI Official Symbol
SPINT1
NCBI Official Synonym Symbols
HAI; HAI1; MANSC2
NCBI Protein Information
kunitz-type protease inhibitor 1
UniProt Protein Name
Kunitz-type protease inhibitor 1
UniProt Gene Name
SPINT1
UniProt Synonym Gene Names
HAI1; HAI-1
UniProt Entry Name
SPIT1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured tissues. Alternative splicing results in multiple variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

SPINT1: Inhibitor of HGF activator. Also acts as an inhibitor of matriptase (ST14). 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 15q15.1

Cellular Component: extracellular region; extracellular space; membrane

Research Articles on SPINT1

Similar Products

Product Notes

The SPINT1 spint1 (Catalog #AAA3214239) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPINT1 antibody - N-terminal region reacts with Cow, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SPINT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPINT1 spint1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GIDLKVQPQE PLVLKDVENT DWRLLRGDTD VRVERKDPNQ VELWGLKEGT. It is sometimes possible for the material contained within the vial of "SPINT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.