Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Regenerating islet-derived protein 3-alpha Recombinant Protein | REG3A recombinant protein

Recombinant Human Regenerating islet-derived protein 3-alpha

Gene Names
REG3A; HIP; PAP; PAP1; REG3; INGAP; PAP-H; PBCGF; HIP/PAP; REG-III
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Regenerating islet-derived protein 3-alpha; Recombinant Human Regenerating islet-derived protein 3-alpha; Hepatointestinal pancreatic protein; HIP/PAP; Human proislet peptide; Pancreatitis-associated protein 1; Regenerating islet-derived protein III-alpha; Reg III-alpha; REG3A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-175aa; Full Length
Sequence
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Sequence Length
175
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for REG3A recombinant protein
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Product Categories/Family for REG3A recombinant protein
References
Cloning and tissue-specific expression of cDNAs for the human and mouse homologues of rat pancreatitis-associated protein (PAP) .Itoh T., Teraoka H.Biochim. Biophys. Acta 1172:184-186(1993) Human pancreatitis-associated protein. Messenger RNA cloning and expression in pancreatic diseases.Orelle B., Keim V., Masciotra L., Dagorn J.-C., Iovanna J.-L.J. Clin. Invest. 90:2284-2291(1992) A novel gene (HIP) activated in human primary liver cancer.Lasserre C., Christa L., Simon M.T., Vernier P., Brechot C.Cancer Res. 52:5089-5095(1992) Molecular cloning, genomic organization, and chromosomal localization of the human pancreatitis-associated protein (PAP) gene.Dusetti N.J., Frigerio J.-M., Fox M.F., Swallow D.M., Dagorn J.-C., Iovanna J.L.Genomics 19:108-114(1994) Structural organization and chromosomal localization of a human gene (HIP/PAP) encoding a C-type lectin overexpressed in primary liver cancer.Lasserre C., Simon M.T., Ishikawa H., Diriong S., Nguyen V.C., Christa L., Vernier P., Brechot C.Eur. J. Biochem. 224:29-38(1994) Proteolytic activation of human pancreatitis-associated protein is required for peptidoglycan binding and bacterial aggregation.Medveczky P., Szmola R., Sahin-Toth M.Biochem. J. 420:335-343(2009) Symbiotic bacteria direct expression of an intestinal bactericidal lectin.Cash H.L., Whitham C.V., Behrendt C.L., Hooper L.V.Science 313:1126-1130(2006) The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury.Lai Y., Li D., Li C., Muehleisen B., Radek K.A., Park H.J., Jiang Z., Li Z., Lei H., Quan Y., Zhang T., Wu Y., Kotol P., Morizane S., Hata T.R., Iwatsuki K., Tang C., Gallo R.L.Immunity 37:74-84(2012) Molecular basis for peptidoglycan recognition by a bactericidal lectin.Lehotzky R.E., Partch C.L., Mukherjee S., Cash H.L., Goldman W.E., Gardner K.H., Hooper L.V.Proc. Natl. Acad. Sci. U.S.A. 107:7722-7727(2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.6 kDa
NCBI Official Full Name
regenerating islet-derived protein 3-alpha
NCBI Official Synonym Full Names
regenerating family member 3 alpha
NCBI Official Symbol
REG3A
NCBI Official Synonym Symbols
HIP; PAP; PAP1; REG3; INGAP; PAP-H; PBCGF; HIP/PAP; REG-III
NCBI Protein Information
regenerating islet-derived protein 3-alpha
UniProt Protein Name
Regenerating islet-derived protein 3-alpha
UniProt Gene Name
REG3A
UniProt Synonym Gene Names
HIP; PAP; PAP1; REG-3-alpha; HIP/PAP; Reg III-alpha
UniProt Entry Name
REG3A_HUMAN

NCBI Description

This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Nov 2014]

Uniprot Description

REG3A: Might be a stress protein involved in the control of bacterial proliferation.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: cytoplasm; extracellular space

Molecular Function: carbohydrate binding; protein binding

Biological Process: acute-phase response; cell proliferation; heterophilic cell adhesion; multicellular organismal development; negative regulation of keratinocyte differentiation

Research Articles on REG3A

Similar Products

Product Notes

The REG3A reg3a (Catalog #AAA969602) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-175aa; Full Length. The amino acid sequence is listed below: EEPQRELPSA RIRCPKGSKA YGSHCYALFL SPKSWTDADL ACQKRPSGNL VSVLSGAEGS FVSSLVKSIG NSYSYVWIGL HDPTQGTEPN GEGWEWSSSD VMNYFAWERN PSTISSPGHC ASLSRSTAFL RWKDYNCNVR LPYVCKFTD. It is sometimes possible for the material contained within the vial of "Regenerating islet-derived protein 3-alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.