Regenerating islet-derived protein 3-gamma Recombinant Protein | Reg3g recombinant protein

Recombinant Mouse Regenerating islet-derived protein 3-gamma

Cat. Num. AAA1213774

• Gene Names: Reg3g; AI449515
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Regenerating islet-derived protein 3-gamma; Recombinant Mouse Regenerating islet-derived protein 3-gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma; Reg3g recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 27-174. Partial-length
• Sequence: EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Reg3g recombinant protein

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L. monocytogenes and methicillin-resistant S. aureus. Regulates keratinocyte proliferation and differentiation after skin injury

References

Structure, chromosomal localization and expression of mouse genes encoding type III Reg, RegIII alpha, RegIII beta, RegIII gamma.Narushima Y., Unno M., Nakagawara K., Mori M., Miyashita H., Suzuki Y., Noguchi N., Takasawa S., Kumagai T., Yonekura H., Okamoto H.Gene 185:159-168(1997) Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment.Mukherjee S., Partch C.L., Lehotzky R.E., Whitham C.V., Chu H., Bevins C.L., Gardner K.H., Hooper L.V.J. Biol. Chem. 284:4881-4888(2009) Refolding, purification, and characterization of human and murine RegIII proteins expressed in Escherichia coli.Cash H.L., Whitham C.V., Hooper L.V.Protein Expr. Purif. 48:151-159(2006) Symbiotic bacteria direct expression of an intestinal bactericidal lectin.Cash H.L., Whitham C.V., Behrendt C.L., Hooper L.V.Science 313:1126-1130(2006) MyD88-mediated signals induce the bactericidal lectin RegIII gamma and protect mice against intestinal Listeria monocytogenes infection.Brandl K., Plitas G., Schnabl B., De;Matteo R.P., Pamer E.G.J. Exp. Med. 204:1891-1900(2007) The antibacterial lectin RegIIIgamma promotes the spatial segregation of microbiota and host in the intestine.Vaishnava S., Yamamoto M., Severson K.M., Ruhn K.A., Yu X., Koren O., Ley R., Wakeland E.K., Hooper L.V.Science 334:255-258(2011) The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury.Lai Y., Li D., Li C., Muehleisen B., Radek K.A., Park H.J., Jiang Z., Li Z., Lei H., Quan Y., Zhang T., Wu Y., Kotol P., Morizane S., Hata T.R., Iwatsuki K., Tang C., Gallo R.L.Immunity 37:74-84(2012) Innate Stat3-mediated induction of the antimicrobial protein Reg3gamma is required for host defense against MRSA pneumonia.Choi S.M., McAleer J.P., Zheng M., Pociask D.A., Kaplan M.H., Qin S., Reinhart T.A., Kolls J.K.J. Exp. Med. 210:551-561(2013)

NCBI and Uniprot Product Information

• NCBI GI #: 6755310
• NCBI GeneID: 19695
• NCBI Accession #: NP_035390.1
• NCBI GenBank Nucleotide #: NM_011260.1
• UniProt Accession #: O09049
• Molecular Weight: 18.3 kDa
• NCBI Official Full Name: regenerating islet-derived protein 3-gamma
• NCBI Official Synonym Full Names: regenerating islet-derived 3 gamma
• NCBI Official Symbol: Reg3g
• NCBI Official Synonym Symbols: AI449515
• NCBI Protein Information: regenerating islet-derived protein 3-gamma
• UniProt Protein Name: Regenerating islet-derived protein 3-gamma
• Protein Family: Regenerating islet-derived protein
• UniProt Gene Name: Reg3g
• UniProt Synonym Gene Names: Pap3; REG-3-gamma; Reg III-gamma
• UniProt Entry Name: REG3G_MOUSE

Uniprot Description

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.