Rabbit anti-Human, Mouse ZNF364 Polyclonal Antibody | anti-ZNF364 antibody
ZNF364 antibody
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ZNF364; Polyclonal Antibody; ZNF364 antibody; Polyclonal ZNF364; Anti-ZNF364; ZNF-364; ZNF 364; Zinc Finger Protein 364; BCA2; RNF115; anti-ZNF364 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
ZNF364 antibody was raised against the C terminal Of Znf364
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZNF364 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
304
Applicable Applications for anti-ZNF364 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
ZNF364 contains 1 RING-type zinc finger. The exact function of ZNF364 remains unknown.
Cross-Reactivity
Human,Mouse
Immunogen
ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-ZNF364 antibody
Rabbit polyclonal ZNF364 antibody raised against the C terminal Of Znf364
Product Categories/Family for anti-ZNF364 antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
34 kDa (MW of target protein)
NCBI Official Full Name
zinc finger protein 364
UniProt Protein Name
E3 ubiquitin-protein ligase RNF115
UniProt Gene Name
RNF115
UniProt Entry Name
RN115_HUMAN
Uniprot Description
ZNF364: Acts as an E2-dependent E3 ubiquitin-protein ligase. May be involved in endocytic trafficking.
Protein type: Ubiquitin ligase; Ligase; EC 6.3.2.-; EC 6.3.2.19; Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 1q21.1
Cellular Component: cytosol
Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity
Biological Process: negative regulation of epidermal growth factor receptor signaling pathway; protein autoubiquitination; ubiquitin-dependent protein catabolic process via the multivesicular body pathway
Similar Products
Product Notes
The ZNF364 rnf115 (Catalog #AAA839912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF364 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF364 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ZNF364 rnf115 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF364, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
