Western Blot (WB)
(TMEM35 antibody (MBS839683) used at 1 ug/ml to detect target protein.)
Rabbit TMEM35 Polyclonal Antibody | anti-TMEM35 antibody
TMEM35 antibody
Gene Names
Tmem35; RSEP4
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM35; Polyclonal Antibody; TMEM35 antibody; Polyclonal TMEM35; Anti-TMEM35; TMEM 35; Transmembrane Protein 35; FLJ14084; TMEM-35; anti-TMEM35 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
TMEM35 antibody was raised against the C terminal of TMEM35
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM35 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
167
Applicable Applications for anti-TMEM35 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TMEM35 antibody (MBS839683) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TMEM35 antibody (MBS839683) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMEM35 antibody
Rabbit polyclonal TMEM35 antibody raised against the C terminal of TMEM35
Product Categories/Family for anti-TMEM35 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18 kDa (MW of target protein)
NCBI Official Full Name
transmembrane protein 35
NCBI Official Synonym Full Names
transmembrane protein 35
NCBI Official Symbol
Tmem35
NCBI Official Synonym Symbols
RSEP4
NCBI Protein Information
transmembrane protein 35
UniProt Protein Name
Transmembrane protein 35
UniProt Gene Name
Tmem35
UniProt Synonym Gene Names
Tuf1
UniProt Entry Name
TMM35_RAT
Uniprot Description
TMEM35: A soluble peptide released by shedding may interact with NGFR and modulate neurite outgrowth. Belongs to the TMEM35 family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: peroxisomal membrane; cytoplasmic membrane-bound vesicle; integral to membrane
Research Articles on TMEM35
Similar Products
Product Notes
The TMEM35 tmem35 (Catalog #AAA839683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM35 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM35 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM35 tmem35 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM35, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
