Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ZNF294 antibody (MBS839052) used at 1 ug/ml to detect target protein.)

Rabbit ZNF294 Polyclonal Antibody | anti-ZNF294 antibody

ZNF294 antibody

Gene Names
LTN1; RNF160; ZNF294; C21orf10; C21orf98
Applications
Western Blot
Purity
Affinity purified
Synonyms
ZNF294; Polyclonal Antibody; ZNF294 antibody; Polyclonal ZNF294; Anti-ZNF294; C21orf10; ZNF 294; RNF160; ZNF-294; KIAA0714; FLJ11053; Ring Finger Protein 160; C21orf98; anti-ZNF294 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
ZNF294 antibody was raised against the N terminal of ZNF294
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZNF294 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1381
Applicable Applications for anti-ZNF294 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Cross-Reactivity
Human
Immunogen
ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(ZNF294 antibody (MBS839052) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (ZNF294 antibody (MBS839052) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ZNF294 antibody
Rabbit polyclonal ZNF294 antibody raised against the N terminal of ZNF294
Product Categories/Family for anti-ZNF294 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
200 kDa (MW of target protein)
NCBI Official Full Name
zinc finger protein 294, isoform CRA_c
NCBI Official Synonym Full Names
listerin E3 ubiquitin protein ligase 1
NCBI Official Symbol
LTN1
NCBI Official Synonym Symbols
RNF160; ZNF294; C21orf10; C21orf98
NCBI Protein Information
E3 ubiquitin-protein ligase listerin
UniProt Protein Name
E3 ubiquitin-protein ligase listerin
UniProt Gene Name
LTN1
UniProt Synonym Gene Names
C21orf10; C21orf98; KIAA0714; RNF160; ZNF294
UniProt Entry Name
LTN1_HUMAN

NCBI Description

Like most RING finger proteins, LTN1 functions as an E3 ubiquitin ligase (Chu et al., 2009 [PubMed 19196968]).[supplied by OMIM, Nov 2010]

Uniprot Description

ZNF294: a zinc-finger protein which contains one RING/zf-C3HC4 domain. The RING finger is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C. Many RING finger proteins play a key role in the ubiquitination pathway. A candidate colon cancer tumor suppressor genes identified using nonsense-mediated mRNA decay in colon cancer cells.

Protein type: EC 6.3.2.-; Ubiquitin ligase; Ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 21q22.11

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein autoubiquitination

Research Articles on ZNF294

Similar Products

Product Notes

The ZNF294 ltn1 (Catalog #AAA839052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZNF294 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ZNF294 ltn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF294, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.