Western Blot (WB)
(PWWP2A antibody (MBS839018) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Rat PWWP2A Polyclonal Antibody | anti-PWWP2A antibody
PWWP2A antibody
Gene Names
PWWP2A; MST101
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
PWWP2A; Polyclonal Antibody; PWWP2A antibody; Polyclonal PWWP2A; Anti-PWWP2A; MGC132770; PWWPA 2; KIAA1935; PWWPA-2; MST101; Pwwp Domain Containing 2A; anti-PWWP2A antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
PWWP2A antibody was raised against the C terminal of PWWP2A
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PWWP2A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
560
Applicable Applications for anti-PWWP2A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown.
Cross-Reactivity
Human,Rat
Immunogen
PWWP2A antibody was raised using the C terminal of PWWP2A corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(PWWP2A antibody (MBS839018) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(PWWP2A antibody (MBS839018) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-PWWP2A antibody
Rabbit polyclonal PWWP2A antibody raised against the C terminal of PWWP2A
Product Categories/Family for anti-PWWP2A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
61 kDa (MW of target protein)
NCBI Official Full Name
PWWP2A protein
NCBI Official Synonym Full Names
PWWP domain containing 2A
NCBI Official Symbol
PWWP2A
NCBI Official Synonym Symbols
MST101
NCBI Protein Information
PWWP domain-containing protein 2A
UniProt Protein Name
PWWP domain-containing protein 2A
Protein Family
UniProt Gene Name
PWWP2A
UniProt Synonym Gene Names
KIAA1935; MST101
UniProt Entry Name
PWP2A_HUMAN
Uniprot Description
PWWP2A: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 5q33.3
Molecular Function: protein binding
Similar Products
Product Notes
The PWWP2A pwwp2a (Catalog #AAA839018) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PWWP2A antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PWWP2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the PWWP2A pwwp2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PWWP2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
