Western Blot (WB)
(TMEM79 antibody (MBS5300665) used at 1 ug/ml to detect target protein.)
Rabbit TMEM79 Polyclonal Antibody | anti-TMEM79 antibody
TMEM79 antibody
Gene Names
TMEM79; MATT
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM79; Polyclonal Antibody; TMEM79 antibody; Polyclonal TMEM79; Anti-TMEM79; FLJ32254; TMEM 79; Transmembrane Protein 79; TMEM-79; MGC13102; FLJ16057; anti-TMEM79 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
TMEM79 antibody was raised against the C terminal of TMEM79
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM79 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
394
Applicable Applications for anti-TMEM79 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM79 is a multi-pass membrane protein. The exact function of TMEM79 remains unknown.
Cross-Reactivity
Human
Immunogen
TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TMEM79 antibody (MBS5300665) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TMEM79 antibody (MBS5300665) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMEM79 antibody
Rabbit polyclonal TMEM79 antibody raised against the C terminal of TMEM79
Product Categories/Family for anti-TMEM79 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43 kDa (MW of target protein)
NCBI Official Full Name
transmembrane protein 79
NCBI Official Synonym Full Names
transmembrane protein 79
NCBI Official Symbol
TMEM79
NCBI Official Synonym Symbols
MATT
NCBI Protein Information
transmembrane protein 79
UniProt Protein Name
Transmembrane protein 79
Protein Family
UniProt Gene Name
TMEM79
UniProt Synonym Gene Names
MATT
UniProt Entry Name
TMM79_HUMAN
Uniprot Description
TMEM79: Contributes to the epidermal integrity and skin barrier function. Plays a role in the lamellar granule (LG) secretory system and in the stratum corneum (SC) epithelial cell formation
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 1q22
Cellular Component: lysosomal membrane; integral to membrane; trans-Golgi network membrane
Biological Process: cuticle development; regulated secretory pathway; hair follicle morphogenesis; epithelial cell maturation; positive regulation of epidermis development
Research Articles on TMEM79
Similar Products
Product Notes
The TMEM79 tmem79 (Catalog #AAA5300665) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TMEM79 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM79 tmem79 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM79, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
