Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: XAF1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human XAF1 Polyclonal Antibody | anti-XAF1 antibody

XAF1 Antibody - middle region

Gene Names
XAF1; BIRC4BP; XIAPAF1; HSXIAPAF1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
XAF1; Polyclonal Antibody; XAF1 Antibody - middle region; anti-XAF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTS
Sequence Length
282
Applicable Applications for anti-XAF1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human XAF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: XAF1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: XAF1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-XAF1 antibody
This gene encodes a protein which binds to and counteracts the inhibitory effect of a member of the IAP (inhibitor of apoptosis) protein family. IAP proteins bind to and inhibit caspases which are activated during apoptosis. The proportion of IAPs and proteins which interfere with their activity, such as the encoded protein, affect the progress of the apoptosis signaling pathway. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-XAF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
XIAP-associated factor 1 isoform 1
NCBI Official Synonym Full Names
XIAP associated factor 1
NCBI Official Symbol
XAF1
NCBI Official Synonym Symbols
BIRC4BP; XIAPAF1; HSXIAPAF1
NCBI Protein Information
XIAP-associated factor 1
UniProt Protein Name
XIAP-associated factor 1
Protein Family
UniProt Gene Name
XAF1
UniProt Synonym Gene Names
BIRC4BP; XIAPAF1
UniProt Entry Name
XAF1_HUMAN

NCBI Description

This gene encodes a protein which binds to and counteracts the inhibitory effect of a member of the IAP (inhibitor of apoptosis) protein family. IAP proteins bind to and inhibit caspases which are activated during apoptosis. The proportion of IAPs and proteins which interfere with their activity, such as the encoded protein, affect the progress of the apoptosis signaling pathway. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

BIRC4BP: Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti- caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha- induced apoptosis and is involved in apoptosis in trophoblast cells. May inhibit BIRC4 indirectly by activating the mitochondrial apoptosis pathway. After translocation to mitochondra, promotes translocation of BAX to mitochondria and cytochrome c release from mitochondria. Seems to promote the redistribution of BIRC4 from the cytoplasm to the nucleus, probably independent of BIRC4 inactivation which seems to occur in the cytoplasm. The BIRC4-XAF1 complex mediates down-regulation of BIRC5/survivin; the process requires the E3 ligase activity of BIRC4. Seems to be involved in cellular sensitivity to the proapoptotic actions of TRAIL. May be a tumor suppressor by mediating apoptosis resistance of cancer cells. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Apoptosis

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: mitochondrion; cytosol; nucleus

Molecular Function: zinc ion binding

Biological Process: apoptosis; cytokine and chemokine mediated signaling pathway; negative regulation of protein complex assembly

Research Articles on XAF1

Similar Products

Product Notes

The XAF1 xaf1 (Catalog #AAA3221647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XAF1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XAF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the XAF1 xaf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSTMEKDVRP KTRSINRFPL HSESSSKKAP RSKNKTLDPL LMSEPKPRTS. It is sometimes possible for the material contained within the vial of "XAF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.