Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (VPS33A polyclonal antibody. Western Blot analysis of VPS33A expression in human pancreas.)

Mouse anti-Human VPS33A Polyclonal Antibody | anti-VPS33A antibody

VPS33A (Vacuolar Protein Sorting-associated Protein 33A, hVPS33A)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
VPS33A; Polyclonal Antibody; VPS33A (Vacuolar Protein Sorting-associated Protein 33A; hVPS33A); Anti -VPS33A (Vacuolar Protein Sorting-associated Protein 33A; anti-VPS33A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human VPS33A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF
Applicable Applications for anti-VPS33A antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human VPS33A, aa1-596 (NP_075067.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(VPS33A polyclonal antibody. Western Blot analysis of VPS33A expression in human pancreas.)

Western Blot (WB) (VPS33A polyclonal antibody. Western Blot analysis of VPS33A expression in human pancreas.)

Western Blot (WB)

(VPS33A polyclonal antibody. Western Blot analysis of VPS33A expression in HepG2.)

Western Blot (WB) (VPS33A polyclonal antibody. Western Blot analysis of VPS33A expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of VPS33A expression in transfected 293T cell line by VPS33A polyclonal antibody. Lane 1: VPS33A transfected lysate (65.56kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VPS33A expression in transfected 293T cell line by VPS33A polyclonal antibody. Lane 1: VPS33A transfected lysate (65.56kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-VPS33A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,611 Da
NCBI Official Full Name
vacuolar protein sorting-associated protein 33A
NCBI Official Synonym Full Names
vacuolar protein sorting 33 homolog A (S. cerevisiae)
NCBI Official Symbol
VPS33A
NCBI Protein Information
vacuolar protein sorting-associated protein 33A; hVPS33A; vacuolar protein sorting 33A
UniProt Protein Name
Vacuolar protein sorting-associated protein 33A
UniProt Gene Name
VPS33A
UniProt Synonym Gene Names
hVPS33A
UniProt Entry Name
VP33A_HUMAN

NCBI Description

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and it encodes a protein similar to the yeast class C Vps33 protein. The mammalian class C VPS proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

VPS33A: May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. Belongs to the STXBP/unc-18/SEC1 family.

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: lysosomal membrane; late endosome membrane; perinuclear region of cytoplasm; early endosome; late endosome

Molecular Function: protein binding

Biological Process: vesicle-mediated transport; protein transport; lysosome localization; melanosome localization; regulation of pigmentation during development; platelet formation; vesicle docking during exocytosis

Research Articles on VPS33A

Similar Products

Product Notes

The VPS33A vps33a (Catalog #AAA6010175) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VPS33A (Vacuolar Protein Sorting-associated Protein 33A, hVPS33A) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VPS33A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the VPS33A vps33a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAHLSYGRV NLNVLREAVR RELREFLDKC AGSKAIVWDE YLTGPFGLIA QYSLLKEHEV EKMFTLKGNR LPAADVKNII FFVRPRLELM DIIAENVLSE DRRGPTRDFH ILFVPRRSLL CEQRLKDLGV LGSFIHREEY SLDLIPFDGD LLSMESEGAF KECYLEGDQT SLYHAAKGLM TLQALYGTIP QIFGKGECAR QVANMMIRMK REFTGSQNSI FPVFDNLLLL DRNVDLLTPL ATQLTYEGLI DEIYGIQNSY VKLPPEKFAP KKQGDGGKDL PTEAKKLQLN SAEELYAEIR DKNFNAVGSV LSKKAKIISA AFEERHNAKT VGEIKQFVSQ LPHMQAARGS LANHTSIAEL IKDVTTSEDF FDKLTVEQEF MSGIDTDKVN NYIEDCIAQK HSLIKVLRLV CLQSVCNSGL KQKVLDYYKR EILQTYGYEH ILTLHNLEKA GLLKPQTGGR NNYPTIRKTL RLWMDDVNEQ NPTDISYVYS GYAPLSVRLA QLLSRPGWRS IEEVLRILPG PHFEERQPLP TGLQKKRQPG ENRVTLIFFL GGVTFAEIAA LRFLSQLEDG GTEYVIATTK LMNGTSWIEA LMEKPF. It is sometimes possible for the material contained within the vial of "VPS33A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.