Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lipocalin 12 antibody (MBS5302085) used at 1 ug/ml to detect target protein.)

Rabbit Lipocalin 12 Polyclonal Antibody | anti-LCN12 antibody

Lipocalin 12 antibody

Applications
Western Blot
Purity
Affinity purified
Synonyms
Lipocalin 12; Polyclonal Antibody; Lipocalin 12 antibody; Polyclonal Lipocalin 12; Anti-Lipocalin 12; MGC34753; MGC48935; LCN12; Lipocalin -12; anti-LCN12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Lipocalin 12 antibody was raised against the N terminal of LCN12
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCN12 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
192
Applicable Applications for anti-LCN12 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Cross-Reactivity
Human
Immunogen
Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Lipocalin 12 antibody (MBS5302085) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Lipocalin 12 antibody (MBS5302085) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-LCN12 antibody
Rabbit polyclonal Lipocalin 12 antibody raised against the N terminal of LCN12
Product Categories/Family for anti-LCN12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
39 kDa (MW of target protein)
NCBI Official Full Name
lipocalin 12
NCBI Official Synonym Full Names
lipocalin 12
NCBI Official Symbol
LCN12
NCBI Protein Information
epididymal-specific lipocalin-12
UniProt Protein Name
Epididymal-specific lipocalin-12
UniProt Gene Name
LCN12
UniProt Entry Name
LCN12_HUMAN

NCBI Description

Members of the lipocalin family, such as LCN12, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to specific cells (Suzuki et al., 2004 [PubMed 15363845]).[supplied by OMIM, Aug 2009]

Uniprot Description

LCN12: Binds all-trans retinoic acid and may act as a retinoid carrier protein within the epididymis. May play a role in male fertility. Belongs to the calycin superfamily. Lipocalin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: extracellular region

Molecular Function: retinoic acid binding; transporter activity

Biological Process: long-chain fatty acid transport; lipid metabolic process; transmembrane transport

Similar Products

Product Notes

The LCN12 lcn12 (Catalog #AAA5302085) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Lipocalin 12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the LCN12 lcn12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Lipocalin 12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.