Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SPRED1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SPRED1 Polyclonal Antibody | anti-SPRED1 antibody

SPRED1 Antibody - middle region

Gene Names
SPRED1; NFLS; hSpred1; spred-1; PPP1R147
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SPRED1; Polyclonal Antibody; SPRED1 Antibody - middle region; anti-SPRED1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFS
Sequence Length
444
Applicable Applications for anti-SPRED1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SPRED1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SPRED1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SPRED1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SPRED1 antibody
The protein encoded by this gene is a member of the Sprouty family of proteins and is phosphorylated by tyrosine kinase in response to several growth factors. The encoded protein can act as a homodimer or as a heterodimer with SPRED2 to regulate activation of the MAP kinase cascade. Defects in this gene are a cause of neurofibromatosis type 1-like syndrome (NFLS).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
sprouty-related, EVH1 domain-containing protein 1
NCBI Official Synonym Full Names
sprouty related EVH1 domain containing 1
NCBI Official Symbol
SPRED1
NCBI Official Synonym Symbols
NFLS; hSpred1; spred-1; PPP1R147
NCBI Protein Information
sprouty-related, EVH1 domain-containing protein 1
UniProt Protein Name
Sprouty-related, EVH1 domain-containing protein 1
UniProt Gene Name
SPRED1
UniProt Synonym Gene Names
Spred-1; hSpred1
UniProt Entry Name
SPRE1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Sprouty family of proteins and is phosphorylated by tyrosine kinase in response to several growth factors. The encoded protein can act as a homodimer or as a heterodimer with SPRED2 to regulate activation of the MAP kinase cascade. Defects in this gene are a cause of neurofibromatosis type 1-like syndrome (NFLS). [provided by RefSeq, Jul 2008]

Uniprot Description

SPRED1: Tyrosine kinase substrate that inhibits growth-factor- mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow. Defects in SPRED1 are the cause of neurofibromatosis type 1-like syndrome (NFLS). It is a disorder characterized mainly by cafe au lait macules without neurofibromas or other tumor manifestations of neurofibromatosis type 1, axillary freckling, and macrocephaly. Additional clinical manifestations include Noonan-like facial dysmorphism, lipomas, learning disabilities and attention deficit-hyperactivity.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: cytoplasm; cytosol; nucleoplasm; plasma membrane

Molecular Function: phosphatase binding; protein binding; protein kinase binding; protein serine/threonine kinase inhibitor activity; stem cell factor receptor binding

Biological Process: fibroblast growth factor receptor signaling pathway; inactivation of MAPK activity; MAPKKK cascade; positive regulation of DNA damage response, signal transduction by p53 class mediator

Disease: Legius Syndrome

Research Articles on SPRED1

Similar Products

Product Notes

The SPRED1 spred1 (Catalog #AAA3221375) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPRED1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPRED1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPRED1 spred1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IRHVSFQDED EIVRINPRDI LIRRYADYRH PDMWKNDLER DDADSSIQFS. It is sometimes possible for the material contained within the vial of "SPRED1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.