Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDK2AP1Sample Tissue: Human Esophagus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CDK2AP1 Polyclonal Antibody | anti-CDK2AP1 antibody

CDK2AP1 Antibody - middle region

Gene Names
CDK2AP1; DOC1; ST19; DORC1; doc-1; p12DOC-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDK2AP1; Polyclonal Antibody; CDK2AP1 Antibody - middle region; anti-CDK2AP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEEL
Sequence Length
115
Applicable Applications for anti-CDK2AP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDK2AP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDK2AP1Sample Tissue: Human Esophagus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDK2AP1Sample Tissue: Human Esophagus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDK2AP1 antibody
The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12 kDa
NCBI Official Full Name
cyclin-dependent kinase 2-associated protein 1 isoform 2
NCBI Official Synonym Full Names
cyclin dependent kinase 2 associated protein 1
NCBI Official Symbol
CDK2AP1
NCBI Official Synonym Symbols
DOC1; ST19; DORC1; doc-1; p12DOC-1
NCBI Protein Information
cyclin-dependent kinase 2-associated protein 1
UniProt Protein Name
Cyclin-dependent kinase 2-associated protein 1
UniProt Gene Name
CDK2AP1
UniProt Synonym Gene Names
CDKAP1; DOC1; CDK2-associated protein 1; DOC-1
UniProt Entry Name
CDKA1_HUMAN

NCBI Description

The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012]

Uniprot Description

CDK2AP1: specific inhibitor of the cell-cycle kinase CDK2. Belongs to the CDK2AP family.

Protein type: Tumor suppressor; DNA replication; Cell cycle regulation

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: perinuclear region of cytoplasm; nucleus

Biological Process: positive regulation of protein amino acid phosphorylation; DNA-dependent DNA replication; cell cycle

Research Articles on CDK2AP1

Similar Products

Product Notes

The CDK2AP1 cdk2ap1 (Catalog #AAA3220448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK2AP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK2AP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK2AP1 cdk2ap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPSTSMATSS QYRQLLSDYG PPSLGYTQGT GNSQVPQSKY AELLAIIEEL. It is sometimes possible for the material contained within the vial of "CDK2AP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.