Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: APPL1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human APPL1 Polyclonal Antibody | anti-APPL1 antibody

APPL1 Antibody - C-terminal region

Gene Names
APPL1; APPL; MODY14; DIP13alpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
APPL1; Polyclonal Antibody; APPL1 Antibody - C-terminal region; anti-APPL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRES
Sequence Length
709
Applicable Applications for anti-APPL1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human APPL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: APPL1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APPL1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-APPL1 antibody
The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80 kDa
NCBI Official Full Name
DCC-interacting protein 13-alpha
NCBI Official Synonym Full Names
adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1
NCBI Official Symbol
APPL1
NCBI Official Synonym Symbols
APPL; MODY14; DIP13alpha
NCBI Protein Information
DCC-interacting protein 13-alpha
UniProt Protein Name
DCC-interacting protein 13-alpha
Protein Family
UniProt Gene Name
APPL1
UniProt Synonym Gene Names
APPL; DIP13A; KIAA1428; Dip13-alpha
UniProt Entry Name
DP13A_HUMAN

NCBI Description

The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq, Jul 2008]

Uniprot Description

APPL: an effector protein of the small GTPase Rab5, a key regulator of endocytosis. Required for the regulation of cell proliferation in response to extracellular signals from an early endosomal compartment. Links Rab5 to nuclear signal transduction. Contains a PH domain and an N-terminal PID domain. Its interaction with RAB5A/Rab5 is essential for its recruitment to endosomal membranes as well as its role in cell proliferation. Binds DCC and the catalytic domain of the inactive form of AKT2 through its PID domain. Binds PIK3CA and subunits of the NuRD/MeCP1 complex. Phosphorylated upon DNA damage.

Protein type: Adaptor/scaffold; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 3p14.3

Cellular Component: early endosome membrane; cytoplasm; endosome membrane; vesicle membrane; NuRD complex; nucleus; cytosol

Molecular Function: protein kinase B binding; identical protein binding; protein binding

Biological Process: cell proliferation; positive regulation of apoptosis; insulin receptor signaling pathway; regulation of glucose import; cell cycle; signal transduction

Disease: Maturity-onset Diabetes Of The Young, Type 14

Research Articles on APPL1

Similar Products

Product Notes

The APPL1 appl1 (Catalog #AAA3222378) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APPL1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APPL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APPL1 appl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QIEKDLEEQS RLIAASSRPN QASSEGQFVV LSSSQSEESD LGEGGKKRES. It is sometimes possible for the material contained within the vial of "APPL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.