Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TMC2 antibody (MBS839021) used at 1 ug/ml to detect target protein.)

Rabbit TMC2 Polyclonal Antibody | anti-TMC2 antibody

TMC2 antibody

Gene Names
TMC2; C20orf145; dJ686C3.3
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMC2; Polyclonal Antibody; TMC2 antibody; Polyclonal TMC2; Anti-TMC2; TMC-2; TMC 2; Transmembrane Channel-Like 2; dJ686C3.3; C20orf145; anti-TMC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
TMC2 antibody was raised against the middle region of TMC2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMC2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
906
Applicable Applications for anti-TMC2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMC2 is considered a member of transmembrane proteins family. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. This gene is considered a member of a gene family predicted to encode transmembrane proteins.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(TMC2 antibody (MBS839021) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (TMC2 antibody (MBS839021) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMC2 antibody
Rabbit polyclonal TMC2 antibody raised against the middle region of TMC2
Product Categories/Family for anti-TMC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
102 kDa (MW of target protein)
NCBI Official Full Name
transmembrane channel-like protein 2
NCBI Official Synonym Full Names
transmembrane channel-like 2
NCBI Official Symbol
TMC2
NCBI Official Synonym Symbols
C20orf145; dJ686C3.3
NCBI Protein Information
transmembrane channel-like protein 2
UniProt Protein Name
Transmembrane channel-like protein 2
UniProt Gene Name
TMC2
UniProt Synonym Gene Names
C20orf145
UniProt Entry Name
TMC2_HUMAN

NCBI Description

This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. Mutations in this gene may underlie hereditary disorders of balance and hearing. [provided by RefSeq, Jul 2008]

Uniprot Description

TMC2: May be required for the normal function of cochlear hair cells. Belongs to the TMC family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: integral to membrane; stereocilium bundle tip

Molecular Function: voltage-gated calcium channel activity

Biological Process: vestibular reflex; detection of mechanical stimulus involved in sensory perception of sound

Research Articles on TMC2

Similar Products

Product Notes

The TMC2 tmc2 (Catalog #AAA839021) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMC2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMC2 tmc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.