Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TIAL1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateTIAL1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit TIAL1 Polyclonal Antibody | anti-TIAL1 antibody

TIAL1 antibody - C-terminal region

Gene Names
TIAL1; TCBP; TIAR
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
TIAL1; Polyclonal Antibody; TIAL1 antibody - C-terminal region; anti-TIAL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
Sequence Length
375
Applicable Applications for anti-TIAL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85%; Zebrafish: 76%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TIAL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TIAL1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateTIAL1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-TIAL1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateTIAL1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-TIAL1 antibody
This is a rabbit polyclonal antibody against TIAL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by TIAL1 is a member of a family of RNA-binding proteins and possesses nucleolytic activity against cytotoxic lymphocyte target cells. The gene product is a cytotoxic granule-associated protein and has been shown to bind specifically to poly(A) homopolymers and to fragment DNA in permeabilized target cells. It has been suggested that members of this protein family may be involved in the induction of apoptosis. One isoform contains a lysosome-targeting motif in its C-terminal auxiliary domain; however, alternative splicing results in a T-cluster DNA-binding isoform, differing at the C-terminus where a hydrophobic sequence replaces the lysosome-targeting motif.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
nucleolysin TIAR isoform 1
NCBI Official Synonym Full Names
TIA1 cytotoxic granule associated RNA binding protein like 1
NCBI Official Symbol
TIAL1
NCBI Official Synonym Symbols
TCBP; TIAR
NCBI Protein Information
nucleolysin TIAR
UniProt Protein Name
Nucleolysin TIAR
Protein Family
UniProt Gene Name
TIAL1
UniProt Entry Name
TIAR_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing. [provided by RefSeq, Jul 2008]

Uniprot Description

TIAL1: a member of a family of RNA-binding proteins that possesses nucleolytic activity. A cytotoxic T cell granule-associated protein that has been shown to bind specifically to poly(A) homopolymers and to fragment DNA in permeabilized target cells. Members of this protein family may be involved in the induction of apoptosis. Two splice variant isoforms have been described.

Protein type: RNA-binding; Apoptosis

Chromosomal Location of Human Ortholog: 10q

Cellular Component: stress granule; lysosome; cytoplasm; nucleus

Molecular Function: RNA binding; nucleotide binding; AU-rich element binding

Biological Process: regulation of transcription from RNA polymerase II promoter; apoptosis; stem cell division; positive regulation of cell proliferation; defense response; germ cell development

Research Articles on TIAL1

Similar Products

Product Notes

The TIAL1 tial1 (Catalog #AAA3224355) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIAL1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TIAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TIAL1 tial1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WNQQGFGVDQ SPSAAWMGGF GAQPPQGQAP PPVIPPPNQA GYGMASYQTQ. It is sometimes possible for the material contained within the vial of "TIAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.