Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Tcf23 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

Rabbit Tcf23 Polyclonal Antibody | anti-TCF23 antibody

Tcf23 antibody - middle region

Gene Names
Tcf23; Out; bHLHa24; 2010002O16Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tcf23; Polyclonal Antibody; Tcf23 antibody - middle region; anti-TCF23 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWP
Sequence Length
209
Applicable Applications for anti-TCF23 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Tcf23 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

Western Blot (WB) (WB Suggested Anti-Tcf23 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)
Related Product Information for anti-TCF23 antibody
This is a rabbit polyclonal antibody against Tcf23. It was validated on Western Blot

Target Description: Tcf23 inhibits E-box-mediated binding and transactivation of bHLH factors. Inhibitory effect is similar to that of ID proteins. Tcf23 inhibits the formation of TCF3 and MYOD1 homo- and heterodimers. Tcf23 lacks DNA binding activity. Tcf23 may be involved in the regulation or modulation of smooth muscle contraction of the uterus during pregnancy and particularly around the time of delivery. Tcf23 seems to play a role in the inhibition of myogenesis.
Product Categories/Family for anti-TCF23 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
transcription factor 23
NCBI Official Synonym Full Names
transcription factor 23
NCBI Official Symbol
Tcf23
NCBI Official Synonym Symbols
Out; bHLHa24; 2010002O16Rik
NCBI Protein Information
transcription factor 23
UniProt Protein Name
Transcription factor 23
Protein Family
UniProt Gene Name
Tcf23
UniProt Synonym Gene Names
Out; TCF-23
UniProt Entry Name
TCF23_MOUSE

Uniprot Description

TCF23: Inhibits E-box-mediated binding and transactivation of bHLH factors. Inhibitory effect is similar to that of ID proteins. Inhibits the formation of TCF3 and MYOD1 homodimers and heterodimers. Lacks DNA binding activity. Seems to play a role in the inhibition of myogenesis.

Protein type: DNA-binding

Cellular Component: nucleus

Molecular Function: protein dimerization activity

Biological Process: muscle development; multicellular organismal development; cell differentiation

Research Articles on TCF23

Similar Products

Product Notes

The TCF23 tcf23 (Catalog #AAA3210118) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tcf23 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tcf23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCF23 tcf23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RQAFLALQAA LPAVPPDTKL SKLDVLVLAT SYIAHLTRTL GHELPGPAWP. It is sometimes possible for the material contained within the vial of "Tcf23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.