Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SPOCK2 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Rabbit SPOCK2 Polyclonal Antibody | anti-SPOCK2 antibody

SPOCK2 antibody - C-terminal region

Gene Names
SPOCK2; testican-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPOCK2; Polyclonal Antibody; SPOCK2 antibody - C-terminal region; anti-SPOCK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHGSP
Sequence Length
424
Applicable Applications for anti-SPOCK2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SPOCK2 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Western Blot (WB) (WB Suggested Anti-SPOCK2 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Related Product Information for anti-SPOCK2 antibody
This is a rabbit polyclonal antibody against SPOCK2. It was validated on Western Blot

Target Description: Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK2 encodes a member of a novel Ca(2+)-binding proteoglycan family.
Product Categories/Family for anti-SPOCK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
testican-2 isoform 2
NCBI Official Synonym Full Names
SPARC (osteonectin), cwcv and kazal like domains proteoglycan 2
NCBI Official Symbol
SPOCK2
NCBI Official Synonym Symbols
testican-2
NCBI Protein Information
testican-2
UniProt Protein Name
Testican-2
Protein Family
UniProt Gene Name
SPOCK2
UniProt Synonym Gene Names
KIAA0275; TICN2
UniProt Entry Name
TICN2_HUMAN

NCBI Description

This gene encodes a protein which binds with glycosaminoglycans to form part of the extracellular matrix. The protein contains thyroglobulin type-1, follistatin-like, and calcium-binding domains, and has glycosaminoglycan attachment sites in the acidic C-terminal region. Three alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

SPOCK2: May participate in diverse steps of neurogenesis. Binds calcium.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10pter-q25.3

Cellular Component: proteinaceous extracellular matrix

Molecular Function: glycosaminoglycan binding; extracellular matrix binding; calcium ion binding

Biological Process: extracellular matrix organization and biogenesis; synaptogenesis; regulation of cell differentiation; signal transduction; peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan

Research Articles on SPOCK2

Similar Products

Product Notes

The SPOCK2 spock2 (Catalog #AAA3215546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPOCK2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SPOCK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPOCK2 spock2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAKKKPGIFI PSCDEDGYYR KMQCDQSSGD CWCVDQLGLE LTGTRTHGSP. It is sometimes possible for the material contained within the vial of "SPOCK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.