Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FGF20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit FGF20 Polyclonal Antibody | anti-FGF20 antibody

FGF20 antibody - C-terminal region

Gene Names
FGF20; RHDA2; FGF-20
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FGF20; Polyclonal Antibody; FGF20 antibody - C-terminal region; anti-FGF20 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKF
Sequence Length
211
Applicable Applications for anti-FGF20 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 77%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FGF20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-FGF20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-FGF20 antibody
This is a rabbit polyclonal antibody against FGF20. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the fibroblast growth factor family. The fibroblast growth factors possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene product is a secreted neurotrophic factor but lacks a typical signal peptide. It is expressed in normal brain, particularly the cerebellum, and may regulate central nervous system development and function. Homodimerization of this protein was shown to regulate its receptor binding activity and concentration gradient in the extracellular matrix. Genetic variations of this gene have been associated with Parkinson disease susceptibility.
Product Categories/Family for anti-FGF20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
fibroblast growth factor 20
NCBI Official Synonym Full Names
fibroblast growth factor 20
NCBI Official Symbol
FGF20
NCBI Official Synonym Symbols
RHDA2; FGF-20
NCBI Protein Information
fibroblast growth factor 20
UniProt Protein Name
Fibroblast growth factor 20
Protein Family
UniProt Gene Name
FGF20
UniProt Synonym Gene Names
FGF-20
UniProt Entry Name
FGF20_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor family. The fibroblast growth factors possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene product is a secreted neurotrophic factor but lacks a typical signal peptide. It is expressed in normal brain, particularly the cerebellum, and may regulate central nervous system development and function. Homodimerization of this protein was shown to regulate its receptor binding activity and concentration gradient in the extracellular matrix. Genetic variations of this gene have been associated with Parkinson disease susceptibility. [provided by RefSeq, Oct 2009]

Uniprot Description

FGF20: Neurotrophic factor that regulates central nervous development and function. Belongs to the heparin-binding growth factors family.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: extracellular region

Molecular Function: 1-phosphatidylinositol-3-kinase activity; growth factor activity; heparan sulfate proteoglycan binding; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity; receptor binding

Biological Process: cell-cell signaling; fibroblast growth factor receptor signaling pathway; MAPKKK cascade; negative regulation of neuron apoptosis; phosphoinositide-mediated signaling; positive regulation of cell proliferation; regulation of dopamine secretion; regulation of phosphoinositide 3-kinase cascade; signal transduction

Disease: Renal Hypodysplasia/aplasia 2

Research Articles on FGF20

Similar Products

Product Notes

The FGF20 fgf20 (Catalog #AAA3216268) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGF20 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FGF20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FGF20 fgf20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IFREQFEENW YNTYSSNIYK HGDTGRRYFV ALNKDGTPRD GARSKRHQKF. It is sometimes possible for the material contained within the vial of "FGF20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.