Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GAS2L1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Spleen)

Rabbit GAS2L1 Polyclonal Antibody | anti-GAS2L1 antibody

GAS2L1 antibody - middle region

Gene Names
GAS2L1; GAR22
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GAS2L1; Polyclonal Antibody; GAS2L1 antibody - middle region; anti-GAS2L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPVSLRSTKEGPETPPRPRDQLPPHPRSRRYSGDSDSSASSAQSGPLGTR
Sequence Length
681
Applicable Applications for anti-GAS2L1 antibody
Western Blot (WB)
Homology
Cow: 85%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GAS2L1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Spleen)

Western Blot (WB) (WB Suggested Anti-GAS2L1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Spleen)
Related Product Information for anti-GAS2L1 antibody
This is a rabbit polyclonal antibody against GAS2L1. It was validated on Western Blot

Target Description: The protein encoded by this gene, a member of the GAS2 family, is similar in sequence to the mouse protein Gas2, an actin-associated protein expressed at high levels in growth-arrested cells. Expression of the mouse Gas2 gene is negatively regulated by serum and growth factors. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-GAS2L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
GAS2-like protein 1 isoform a
NCBI Official Synonym Full Names
growth arrest specific 2 like 1
NCBI Official Symbol
GAS2L1
NCBI Official Synonym Symbols
GAR22
NCBI Protein Information
GAS2-like protein 1
UniProt Protein Name
GAS2-like protein 1
Protein Family
UniProt Gene Name
GAS2L1
UniProt Synonym Gene Names
GAR22
UniProt Entry Name
GA2L1_HUMAN

NCBI Description

This gene encodes a member of the growth arrest-specific 2 protein family. This protein binds components of the cytoskeleton and may be involved in mediating interactions between microtubules and microfilaments. This protein localizes to the proximal end of mature centrioles and links centrosomes to both microtubules and actin. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 9. [provided by RefSeq, May 2018]

Uniprot Description

GAS2L1: Seems to be involved in the cross-linking of microtubules and microfilaments. Belongs to the GAS2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: microtubule; cytoskeleton; cytoplasm; stress fiber

Molecular Function: microtubule binding; cytoskeletal adaptor activity; thyroid hormone receptor binding

Biological Process: negative regulation of erythrocyte differentiation; regulation of cell cycle; negative regulation of microtubule depolymerization; negative regulation of cell growth; cell cycle arrest; cellular response to starvation; microtubule bundle formation

Research Articles on GAS2L1

Similar Products

Product Notes

The GAS2L1 gas2l1 (Catalog #AAA3210658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAS2L1 antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GAS2L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GAS2L1 gas2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPVSLRSTKE GPETPPRPRD QLPPHPRSRR YSGDSDSSAS SAQSGPLGTR. It is sometimes possible for the material contained within the vial of "GAS2L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.