Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZC3H12A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit ZC3H12A Polyclonal Antibody | anti-ZC3H12A antibody

ZC3H12A antibody - C-terminal region

Gene Names
MRPS11; HCC-2; S11mt; MRP-S11
Reactivity
Cow, Dog, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZC3H12A; Polyclonal Antibody; ZC3H12A antibody - C-terminal region; anti-ZC3H12A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLT
Sequence Length
599
Applicable Applications for anti-ZC3H12A antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 86%; Horse: 92%; Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZC3H12A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-ZC3H12A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-ZC3H12A antibody
This is a rabbit polyclonal antibody against ZC3H12A. It was validated on Western Blot

Target Description: ZC3H12A is an MCP1-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.
Product Categories/Family for anti-ZC3H12A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
28S ribosomal protein S11, mitochondrial isoform b
NCBI Official Synonym Full Names
mitochondrial ribosomal protein S11
NCBI Official Symbol
MRPS11
NCBI Official Synonym Symbols
HCC-2; S11mt; MRP-S11
NCBI Protein Information
28S ribosomal protein S11, mitochondrial
UniProt Protein Name
28S ribosomal protein S11, mitochondrial
Protein Family
UniProt Gene Name
MRPS11
UniProt Synonym Gene Names
RPMS11; MRP-S11; S11mt; HCC-2
UniProt Entry Name
RT11_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2016]

Uniprot Description

MRPS11: a mitochondrial ribosomal protein encoded by a nuclear gene that helps in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2008]

Protein type: Ribosomal; RNA-binding; Mitochondrial; Translation

Chromosomal Location of Human Ortholog: 15q25

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial small ribosomal subunit

Molecular Function: structural constituent of ribosome

Biological Process: mitochondrial translation; organelle organization and biogenesis; DNA damage response, detection of DNA damage

Research Articles on ZC3H12A

Similar Products

Product Notes

The ZC3H12A mrps11 (Catalog #AAA3215668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZC3H12A antibody - C-terminal region reacts with Cow, Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZC3H12A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZC3H12A mrps11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FFHPERPSCP QRSVADELRA NALLSPPRAP SKDKNGRRPS PSSQSSSLLT. It is sometimes possible for the material contained within the vial of "ZC3H12A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.