Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: MDA-MB231, MCF7Lanes :Lane 1: 10ug MDA-MB231 lysateLane 2: 10ug MCF7 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :ID4Submitted by :Maria Teresita Branham. Facultad de Cs Médicas-UNCuyo)

Rabbit ID4 Polyclonal Antibody | anti-ID4 antibody

ID4 antibody - middle region

Gene Names
ID4; IDB4; bHLHb27
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ID4; Polyclonal Antibody; ID4 antibody - middle region; anti-ID4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
Sequence Length
161
Applicable Applications for anti-ID4 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 100%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ID4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: MDA-MB231, MCF7Lanes :Lane 1: 10ug MDA-MB231 lysateLane 2: 10ug MCF7 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :ID4Submitted by :Maria Teresita Branham. Facultad de Cs Médicas-UNCuyo)

Western Blot (WB) (Sample Type: MDA-MB231, MCF7Lanes :Lane 1: 10ug MDA-MB231 lysateLane 2: 10ug MCF7 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :ID4Submitted by :Maria Teresita Branham. Facultad de Cs Médicas-UNCuyo)

Western Blot (WB)

(WB Suggested Anti-ID4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateID4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-ID4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateID4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-ID4 antibody
This is a rabbit polyclonal antibody against ID4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins.Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 [PubMed 7665172]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
DNA-binding protein inhibitor ID-4
NCBI Official Synonym Full Names
inhibitor of DNA binding 4, HLH protein
NCBI Official Symbol
ID4
NCBI Official Synonym Symbols
IDB4; bHLHb27
NCBI Protein Information
DNA-binding protein inhibitor ID-4
UniProt Protein Name
DNA-binding protein inhibitor ID-4
UniProt Gene Name
ID4
UniProt Synonym Gene Names
BHLHB27; bHLHb27
UniProt Entry Name
ID4_HUMAN

NCBI Description

This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. [provided by RefSeq, Aug 2017]

Uniprot Description

ID4: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription corepressor activity

Biological Process: fat cell differentiation; circadian rhythm; transcription, DNA-dependent; myelination in the central nervous system; hippocampus development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of fat cell differentiation; cerebral cortex neuron differentiation; regulation of transcription from RNA polymerase II promoter; negative regulation of oligodendrocyte differentiation; positive regulation of osteoblast differentiation; negative regulation of neuron differentiation; positive regulation of cell proliferation; negative regulation of astrocyte differentiation; neuroblast proliferation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; G1/S transition of mitotic cell cycle

Research Articles on ID4

Similar Products

Product Notes

The ID4 id4 (Catalog #AAA3200864) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ID4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ID4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ID4 id4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CYSRLRRLVP TIPPNKKVSK VEILQHVIDY ILDLQLALET HPALLRQPPP. It is sometimes possible for the material contained within the vial of "ID4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.