Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STX7 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellSTX7 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit STX7 Polyclonal Antibody | anti-STX7 antibody

STX7 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STX7; Polyclonal Antibody; STX7 antibody - N-terminal region; anti-STX7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS
Sequence Length
261
Applicable Applications for anti-STX7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STX7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STX7 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellSTX7 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-STX7 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellSTX7 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-STX7 antibody
This is a rabbit polyclonal antibody against STX7. It was validated on Western Blot

Target Description: STX7 may be involved in protein trafficking from the plasma membrane to the early endosome (EE) as well as in homotypic fusion of endocytic organelles. STX7 mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes.
Product Categories/Family for anti-STX7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
syntaxin-7 isoform a
NCBI Official Synonym Full Names
syntaxin 7
NCBI Official Symbol
STX7
NCBI Protein Information
syntaxin-7
UniProt Protein Name
Syntaxin-7
Protein Family
UniProt Gene Name
STX7
UniProt Entry Name
STX7_HUMAN

NCBI Description

The protein encoded by this gene is a syntaxin family membrane receptor involved in vesicle transport. The encoded protein binds alpha-SNAP, an important regulator of transport vesicle fusion. Along with syntaxin 13, this protein plays a role in the ordered fusion of endosomes and lysosomes with the phagosome. [provided by RefSeq, May 2016]

Uniprot Description

STX7: May be involved in protein trafficking from the plasma membrane to the early endosome (EE) as well as in homotypic fusion of endocytic organelles. Mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes. Belongs to the syntaxin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q23.1

Cellular Component: intracellular membrane-bound organelle; lysosomal membrane; lysosome; early endosome; integral to membrane; immunological synapse; endomembrane system; SNARE complex; azurophil granule; recycling endosome; endocytic vesicle; perinuclear region of cytoplasm; early endosome membrane; late endosome; plasma membrane; vesicle; endosome

Molecular Function: SNAP receptor activity; SNARE binding; chloride channel inhibitor activity; syntaxin binding

Biological Process: vesicle fusion; intracellular protein transport; organelle localization; vesicle docking; positive regulation of T cell mediated cytotoxicity

Research Articles on STX7

Similar Products

Product Notes

The STX7 stx7 (Catalog #AAA3215086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STX7 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STX7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STX7 stx7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSEQRQRKIQ KDRLVAEFTT SLTNFQKVQR QAAEREKEFV ARVRASSRVS. It is sometimes possible for the material contained within the vial of "STX7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.