Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-C11orf2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellVPS51 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit C11orf2 Polyclonal Antibody | anti-VPS51 antibody

C11orf2 Antibody - C-terminal region

Gene Names
VPS51; FFR; ANG2; ANG3; C11orf2; C11orf3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C11orf2; Polyclonal Antibody; C11orf2 Antibody - C-terminal region; anti-VPS51 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEGVRKAQSSDSSKRTFSVYSSSRQQGRYAPSYTPSAPMDTNLLSNIQKL
Sequence Length
782
Applicable Applications for anti-VPS51 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C11orf2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-C11orf2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellVPS51 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-C11orf2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellVPS51 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-VPS51 antibody
This is a rabbit polyclonal antibody against C11orf2. It was validated on Western Blot

Target Description: C11orf2 is required for both Golgi structure and vesicular trafficking, and ultimately lipid transport.
Product Categories/Family for anti-VPS51 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
738
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
vacuolar protein sorting-associated protein 51 homolog
NCBI Official Synonym Full Names
VPS51 subunit of GARP complex
NCBI Official Symbol
VPS51
NCBI Official Synonym Symbols
FFR; ANG2; ANG3; C11orf2; C11orf3
NCBI Protein Information
vacuolar protein sorting-associated protein 51 homolog
UniProt Protein Name
Vacuolar protein sorting-associated protein 51 homolog
UniProt Gene Name
VPS51
UniProt Synonym Gene Names
ANG2; C11orf2; C11orf3; FFR
UniProt Entry Name
VPS51_HUMAN

NCBI Description

This gene encodes a member of the vacuolar protein sorting-associated protein 51 family. The encoded protein is a component of the Golgi-associated retrograde protein complex which acts as a tethering factor for carriers in retrograde transport from the early and late endosomes to the trans-Golgi network. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]

Uniprot Description

FFR: Acts as component of the GARP complex that is involved in retrograde transport from early and late endosomes to the trans-Golgi networkl (TGN). The GARP complex is required for the maintenance of protein retrieval from endosomes to the TGN, acid hydrolase sorting, lysosome function, endosomal cholesterol traffic and autophagy. VPS51 participates in retrograde transport of acid hydrolase receptors, likely by promoting tethering and SNARE-dependent fusion of endosome-derived carriers to the TGN. Belongs to the VPS51 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi apparatus; integral to membrane

Molecular Function: protein binding

Biological Process: protein transport; autophagy; lipid transport; retrograde transport, endosome to Golgi

Research Articles on VPS51

Similar Products

Product Notes

The VPS51 vps51 (Catalog #AAA3217470) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C11orf2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's C11orf2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VPS51 vps51 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEGVRKAQSS DSSKRTFSVY SSSRQQGRYA PSYTPSAPMD TNLLSNIQKL. It is sometimes possible for the material contained within the vial of "C11orf2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.