Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NUP54 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellNUP54 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Rabbit NUP54 Polyclonal Antibody | anti-NUP54 antibody

NUP54 Antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUP54; Polyclonal Antibody; NUP54 Antibody - C-terminal region; anti-NUP54 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRL
Sequence Length
507
Applicable Applications for anti-NUP54 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUP54
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NUP54 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellNUP54 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Western Blot (WB) (WB Suggested Anti-NUP54 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellNUP54 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)
Related Product Information for anti-NUP54 antibody
This is a rabbit polyclonal antibody against NUP54. It was validated on Western Blot

Target Description: The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. This gene encodes a member of the phe-gly (FG) repeat-containing nucleoporin subset.
Product Categories/Family for anti-NUP54 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
nucleoporin p54 isoform 1
NCBI Official Synonym Full Names
nucleoporin 54
NCBI Official Symbol
NUP54
NCBI Protein Information
nucleoporin p54
UniProt Protein Name
Nucleoporin p54
Protein Family
UniProt Gene Name
NUP54
UniProt Entry Name
NUP54_HUMAN

NCBI Description

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. This gene encodes a member of the phe-gly (FG) repeat-containing nucleoporin subset. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2013]

Research Articles on NUP54

Similar Products

Product Notes

The NUP54 nup54 (Catalog #AAA3217178) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUP54 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NUP54 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUP54 nup54 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGVDPIIWEQ AKVDNPDSEK LIPVPMVGFK ELLRRLKVQD QMTKQHQTRL. It is sometimes possible for the material contained within the vial of "NUP54, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.