Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FLOT1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)

Rabbit FLOT1 Polyclonal Antibody | anti-FLOT1 antibody

FLOT1 Antibody - middle region

Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FLOT1; Polyclonal Antibody; FLOT1 Antibody - middle region; anti-FLOT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAY
Sequence Length
427
Applicable Applications for anti-FLOT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human FLOT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FLOT1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)

Western Blot (WB) (WB Suggested Anti-FLOT1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)
Related Product Information for anti-FLOT1 antibody
This is a rabbit polyclonal antibody against FLOT1. It was validated on Western Blot

Target Description: Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined.
Product Categories/Family for anti-FLOT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
flotillin-1 isoform 1
NCBI Official Synonym Full Names
flotillin 1
NCBI Official Symbol
FLOT1
NCBI Protein Information
flotillin-1
UniProt Protein Name
Flotillin-1
Protein Family
UniProt Gene Name
FLOT1
UniProt Entry Name
FLOT1_HUMAN

NCBI Description

This gene encodes an protein that localizes to the caveolae, which are small domains on the inner cell membranes. This protein plays a role in vesicle trafficking and cell morphology. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

FLOT1: May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. Heterooligomeric complex of flotillin-1 and flotillin-2 and caveolin-1 and caveolin-2. Interacts with ECM29. Belongs to the band 7/mec-2 family. Flotillin subfamily.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: signalosome; focal adhesion; membrane; lysosomal membrane; integral to membrane; melanosome; microtubule organizing center; caveola; flotillin complex; sarcolemma; endosome; lipid raft

Molecular Function: ionotropic glutamate receptor binding; protein binding; protease binding

Biological Process: extracellular matrix disassembly; axonogenesis; regulation of Rho protein signal transduction

Research Articles on FLOT1

Similar Products

Product Notes

The FLOT1 flot1 (Catalog #AAA3216899) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLOT1 Antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FLOT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FLOT1 flot1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IREAKAKQEK VSAQYLSEIE MAKAQRDYEL KKAAYDIEVN TRRAQADLAY. It is sometimes possible for the material contained within the vial of "FLOT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.