Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STX3Sample Tissue: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human STX3 Polyclonal Antibody | anti-STX3 antibody

STX3 Antibody - middle region

Gene Names
STX3; STX3A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
STX3; Polyclonal Antibody; STX3 Antibody - middle region; anti-STX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD
Sequence Length
277
Applicable Applications for anti-STX3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human STX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STX3Sample Tissue: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STX3Sample Tissue: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-STX3 antibody
synapsin I

Target Description: The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle fusion and exocytosis. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-STX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
syntaxin-3 isoform 2
NCBI Official Synonym Full Names
syntaxin 3
NCBI Official Symbol
STX3
NCBI Official Synonym Symbols
STX3A
NCBI Protein Information
syntaxin-3
UniProt Protein Name
Syntaxin-3
Protein Family
UniProt Gene Name
STX3
UniProt Synonym Gene Names
STX3A
UniProt Entry Name
STX3_HUMAN

NCBI Description

The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle fusion and exocytosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]

Uniprot Description

STX3: Potentially involved in docking of synaptic vesicles at presynaptic active zones. Belongs to the syntaxin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q12.1

Cellular Component: SNARE complex; synaptic vesicle; specific granule; azurophil granule; neuron projection; growth cone; lamellipodium; apical plasma membrane; dendrite; plasma membrane; integral to membrane; vacuole; intercellular junction

Molecular Function: arachidonic acid binding; SNAP receptor activity; protein binding; SNARE binding

Biological Process: synaptic vesicle fusion to presynaptic membrane; intracellular protein transport; vesicle docking; positive regulation of cell adhesion; positive regulation of chemotaxis; positive regulation of cell proliferation; neurite development

Research Articles on STX3

Similar Products

Product Notes

The STX3 stx3 (Catalog #AAA3214381) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STX3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STX3 stx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRNKLKSMEK HIEEDEVRSS ADLRIRKSQH SVLSRKFVEV MTKYNEAQVD. It is sometimes possible for the material contained within the vial of "STX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.