Western Blot (WB)
(Host: RabbitTarget Name: 6330545A04RikSample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Rabbit 6330545A04Rik Polyclonal Antibody | anti-RSG1 antibody
6330545A04Rik Antibody - N-terminal region
Gene Names
Cplane2; Rsg1; Gm723; b2b2804Clo; b2b2827Clo; 6330545A04Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
6330545A04Rik; Polyclonal Antibody; 6330545A04Rik Antibody - N-terminal region; anti-RSG1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP
Sequence Length
258
Applicable Applications for anti-RSG1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 83%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 6330545A04Rik
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: 6330545A04RikSample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: 6330545A04RikSample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RSG1 antibody
This is a rabbit polyclonal antibody against 6330545A04Rik. It was validated on Western Blot
Target Description: 6330545A04Rik has a potential effector of the planar cell polarity signaling pathway. It plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. It is involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia and is more generally involved in exocytosis in secretory cells.
Target Description: 6330545A04Rik has a potential effector of the planar cell polarity signaling pathway. It plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. It is involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia and is more generally involved in exocytosis in secretory cells.
Product Categories/Family for anti-RSG1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
ciliogenesis and planar polarity effector 2
NCBI Official Synonym Full Names
ciliogenesis and planar polarity effector 2
NCBI Official Symbol
Cplane2
NCBI Official Synonym Symbols
Rsg1; Gm723; b2b2804Clo; b2b2827Clo; 6330545A04Rik
NCBI Protein Information
ciliogenesis and planar polarity effector 2; REM2- and Rab-like small GTPase 1
UniProt Protein Name
REM2- and Rab-like small GTPase 1
Protein Family
UniProt Gene Name
Rsg1
UniProt Synonym Gene Names
Gm723
Uniprot Description
Potential effector of the planar cell polarity signaling pathway. Plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. Involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia. More generally involved in exocytosis in secretory cells ().
Research Articles on RSG1
Similar Products
Product Notes
The RSG1 rsg1 (Catalog #AAA3217419) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The 6330545A04Rik Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's 6330545A04Rik can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RSG1 rsg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NRRREFGLLE RPVLPPSVVI DTASYKIFVS GKSGVGKTAL VAKLAGLEVP. It is sometimes possible for the material contained within the vial of "6330545A04Rik, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
