Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Syt1Sample Type: Rat Stomach lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Syt1 Polyclonal Antibody | anti-SYT1 antibody

Syt1 Antibody - N-terminal region

Gene Names
Syt1; P65
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Syt1; Polyclonal Antibody; Syt1 Antibody - N-terminal region; anti-SYT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDF
Sequence Length
421
Applicable Applications for anti-SYT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Syt1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Syt1Sample Type: Rat Stomach lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Syt1Sample Type: Rat Stomach lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SYT1 antibody
This is a rabbit polyclonal antibody against Syt1. It was validated on Western Blot

Target Description: Syt1 is a integral component of synaptic vesicle membranes; It is important for exocytosis and vesicle trafficking to the active zone of synapses and may be the calcium sensor for calcium-dependent exocytosis.
Product Categories/Family for anti-SYT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
synaptotagmin-1
NCBI Official Synonym Full Names
synaptotagmin 1
NCBI Official Symbol
Syt1
NCBI Official Synonym Symbols
P65
NCBI Protein Information
synaptotagmin-1
UniProt Protein Name
Synaptotagmin-1
Protein Family
UniProt Gene Name
Syt1
UniProt Synonym Gene Names
SytI
UniProt Entry Name
SYT1_RAT

NCBI Description

integral component of synaptic vesicle membranes; important for exocytosis and vesicle trafficking to the active zone of synapses; may be the calcium sensor for calcium-dependent exocytosis [RGD, Feb 2006]

Uniprot Description

SYT1: an integral membrane protein of synaptic vesicles thought to serve as a Ca(2+) sensor in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin I participates in triggering neurotransmitter release at the synapse. Binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2.

Protein type: Calcium-binding; Vesicle; Membrane protein, integral

Cellular Component: neuron projection; synaptic vesicle membrane; cell; integral to membrane; excitatory synapse; terminal button; intracellular organelle; secretory granule; presynaptic membrane; SNARE complex; synaptic vesicle; cytoplasm; plasma membrane; cell junction

Molecular Function: protein C-terminus binding; identical protein binding; clathrin binding; calcium-dependent phospholipid binding; transporter activity; calcium ion binding; calcium-dependent protein binding; calmodulin binding; phosphatidylinositol-4,5-bisphosphate binding; SNARE binding; protein binding; syntaxin binding; low-density lipoprotein receptor binding; phosphatidylserine binding; syntaxin-1 binding; phospholipid binding

Biological Process: positive regulation of calcium ion-dependent exocytosis; synaptic vesicle exocytosis; vesicle docking; regulation of synaptic transmission, glutamatergic; neurotransmitter secretion; positive regulation of vesicle fusion; detection of calcium ion; response to calcium ion; regulation of calcium ion-dependent exocytosis; positive regulation of synaptic transmission; calcium ion-dependent exocytosis

Research Articles on SYT1

Similar Products

Product Notes

The SYT1 syt1 (Catalog #AAA3214343) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Syt1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Syt1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYT1 syt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDVKDLGKTM KDQALKDDDA ETGLTDGEEK EEPKEEEKLG KLQYSLDYDF. It is sometimes possible for the material contained within the vial of "Syt1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.