Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STK38 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that STK38 is expressed in HepG2)

Rabbit STK38 Polyclonal Antibody | anti-STK38 antibody

STK38 antibody - C-terminal region

Gene Names
STK38; NDR; NDR1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STK38; Polyclonal Antibody; STK38 antibody - C-terminal region; anti-STK38 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD
Sequence Length
465
Applicable Applications for anti-STK38 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STK38
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STK38 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that STK38 is expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-STK38 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that STK38 is expressed in HepG2)
Related Product Information for anti-STK38 antibody
This is a rabbit polyclonal antibody against STK38. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.
Product Categories/Family for anti-STK38 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
serine/threonine-protein kinase 38
NCBI Official Synonym Full Names
serine/threonine kinase 38
NCBI Official Symbol
STK38
NCBI Official Synonym Symbols
NDR; NDR1
NCBI Protein Information
serine/threonine-protein kinase 38
UniProt Protein Name
Serine/threonine-protein kinase 38
UniProt Gene Name
STK38
UniProt Entry Name
STK38_HUMAN

NCBI Description

This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Uniprot Description

NDR1: is an AGC kinase of the NDR family. An apparent upstream regulator of Myc activity in human B-cell lymphoma. Mediates apoptosis downstream of the tumor suppressor proteins RASSF1A and MST1. Reduced expression of NDR1 results in defective apoptotic responses and a predisposition to develop T cell lymphoma in mice. Activated by binding of S100B which releases autoinhibitory N-lobe interactions. Ubiquitously expressed with highest levels observed in peripheral blood leukocytes.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; Protein kinase, AGC; AGC group; NDR family

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; magnesium ion binding; mitogen-activated protein kinase kinase kinase binding; ATP binding

Biological Process: negative regulation of MAP kinase activity; protein modification process; protein amino acid phosphorylation

Research Articles on STK38

Similar Products

Product Notes

The STK38 stk38 (Catalog #AAA3209141) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK38 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STK38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STK38 stk38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IGAPGVEEIK SNSFFEGVDW EHIRERPAAI SIEIKSIDDT SNFDEFPESD. It is sometimes possible for the material contained within the vial of "STK38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.