Western Blot (WB)
(WB Suggested Anti-RAB11B Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateRAB11B is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit RAB11B Polyclonal Antibody | anti-RAB11B antibody
RAB11B antibody - C-terminal region
Gene Names
RAB11B; H-YPT3; NDAGSCW
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB11B; Polyclonal Antibody; RAB11B antibody - C-terminal region; anti-RAB11B antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV
Sequence Length
218
Applicable Applications for anti-RAB11B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB11B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RAB11B Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateRAB11B is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-RAB11B Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateRAB11B is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-RAB11B antibody
This is a rabbit polyclonal antibody against RAB11B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RAB11B possesses GTPase activity.
Target Description: RAB11B possesses GTPase activity.
Product Categories/Family for anti-RAB11B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-11B
NCBI Official Synonym Full Names
RAB11B, member RAS oncogene family
NCBI Official Symbol
RAB11B
NCBI Official Synonym Symbols
H-YPT3; NDAGSCW
NCBI Protein Information
ras-related protein Rab-11B
UniProt Protein Name
Ras-related protein Rab-11B
Protein Family
UniProt Gene Name
RAB11B
UniProt Synonym Gene Names
YPT3
UniProt Entry Name
RB11B_HUMAN
NCBI Description
The Ras superfamily of small GTP-binding proteins, which includes the Ras (see MIM 190020), Ral (see MIM 179550), Rho (see MIM 165390), Rap (see MIM 179520), and Rab (see MIM 179508) families, is involved in controlling a diverse set of essential cellular functions. The Rab family, including RAB11B, appears to play a critical role in regulating exocytotic and endocytotic pathways (summary by Zhu et al., 1994 [PubMed 7811277]).[supplied by OMIM, Nov 2010]
Research Articles on RAB11B
Similar Products
Product Notes
The RAB11B rab11b (Catalog #AAA3208940) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB11B antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB11B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB11B rab11b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IETSALDSTN VEEAFKNILT EIYRIVSQKQ IADRAAHDES PGNNVVDISV. It is sometimes possible for the material contained within the vial of "RAB11B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
